Biological Product & Supplies

Сhlamydia trachomatis/Ureaplasma/M.genitalium Real-TM, CE, 100T Multiplex Real Time PCR test | 0441-B46-100FRT| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

ω-agatoxin-IVA, 0, 5 mg | 0466-11AGA001-00500| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

ω-Conotoxin-GVIA, 0.5 mg | 0466-08CON003-00500| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

δ-1, 2, 3, 4, 5, 6-Hexachlorocyclohexane | 0572-H290800-1G| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-[Ethyl-CONH-(PEG4)]-ATP-Biotin | 0220-NU-927-BIO| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-[(8-Aminooctyl)-imido]-ATP | 0220-NU-815L| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-PEG8-ATP-Biotin | 0220-NU-926-BIO| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-(6-Azidohexyl)-ATP 5 x 50 μl (10 mM) | 0220-NU-1702L| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-(6-Aminohexyl)-ATP-Cy5 | 0220-NU-833-CY5| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-(6-Aminohexyl)-ATP-Biotin | 0220-NU-833-BIO| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-(6-Aminohexyl)-ATP-ATTO-647N | 0220-NU-833-647N| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

γ-(2-Azidoethyl)-ATP 5 x 100 μl (10 mM) | 0220-NU-1701L| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

β-Hexosaminidase Activity Assay | 0900-TBS2105-100| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

β-HCG | 0486-E-79-96| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

β-Glucosidase (Aspergillus niger) 200 units | 0956-E-BGLUC| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

β-Galactosidase from Escherichia coli | 0917-G6008-1KU| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

β-Amyloid (1-42), (rat/mouse) (TFA), 10 mg | 0931-T35499-10 MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

α-MEM with L-Gln, Ribonucleosides and Deoxyribonucleosides, liquid | 0203-21444-05-500| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

α-Bungarotoxin, CF® Dye and Other Conjugates CF488A, 0.5mg | 0037-00005| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

α-Amylase Activity Assay | 0986-MA-0138| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

½” solid probe (20-250 mL) | 0549-Q4219| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

watersafe WS425B | 1052-WS425B| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

vCal™ Rainbow nanoBeads | 1126-CBS6-2.5ml| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Mouse nanoCal™ beads | 1126-CBS7M-2.5ml| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

trypsin\EDTA Solution 0.05%, 100 ml | 0171-TM050| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

trans-ISRIB, 10 mg | 0622-5284| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

tissue-tek Xpress X120 Processing Reagent Set | 0094-7730| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

tdTomato Goat Polyclonal Antibody, 600ug | 0894-AB8181-200| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

tDenHyb-2 (For tissue FISH with unique sequence probes) | 0310-D102| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

tDenHyb-1 (For general tissue FISH) | 0310-D101| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

synomag®-D streptavidin, 70 nm, 5 mg/ml | 0612-104-19-701| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

synomag®-D streptavidin, 50 nm, 5 mg/ml | 0612-104-19-501| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

stomer service:Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3 MG | 0399-CSB-CS(P)-006-3MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

soluble epoxide hydrolase: ~100 U/mg | 0731-EXWM-3995-50µg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

smURFP-N1 plasmid, 2ug | 0820-PVT40117| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

shp53 pLKO.1 puro Plasmid, 2 ug | 0820-PVT18229| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rgpB Antibody, HRP conjugated | 0399-CSB-PA310587LB01EYA-50UG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rgpB Antibody, HRP conjugated | 0399-CSB-PA310587LB01EYA-100UG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rgpB Antibody | 0399- CSB-PA310587LA01EYA-50mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rgpB Antibody | 0399-CSB-PA310587LA01EYA-100ug| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rgpA Antibody, 50 ug | 0399-CSB-PA338957LA01PQP-50UG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rgpA Antibody | 0399-CSB-PA338957LA01PQP| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rHu IL2, 3MIU | 0004-RHIL2-08F02| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

rAAV-GfaABC1D-ChrimsonR-mCherry-WPRE-SV40 pA, AAV2/5 -≥5.00E+12vg/mL | 1067-PT-7019-40µl| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

r-KSTI, 1 mg | 0963-NRPA29S-1| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

qPCR Probe Master Mix | 0813-Q112-02| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

qPCR Probe Master Mix | 0813-Q112-03| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

proDynorphin | 0089-GP10110-50 ul| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pmCherry- C1 plasmid | 0820-PVT1233| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

perimag®plain, 130 nm, 25 mg/ml | 0612-102-00-132| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pcDNA3.1-WASF2 | 0820-PVT51408| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pcDNA3.1-KCNMA1 | 0820-PVT51407| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pcDNA3.1-HA-Ubiquitin Plasmid, 2 ug | 0820-PVTB00017-2e| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pcDNA3.1-Flag-RELA Plasmid, 2 ug | 0820-PVTB00135-2d| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pan HPV BIO DNA probe | A100P.0100 | 0784-A100P.0100| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pYES3/ CT, 2 ug | 0820-PVT11237| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pYES-DEST52 | 0820-PVT22154| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pYD1 | 0820-PVT11284| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pWB980, 2 ug | 0820-PVT5015| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pUZ8002 plasmid | 0820-PVT12448| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pUTKM1 plasmid | 0820-PVT6021| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pUCP18 | 0820-PVT33533| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pUC57- Kan | 0820-PVT10562| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pTargetF | 0820-PVT10638| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pTT5 | 0820-PVTY00298| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pTA7001-DEST plasmid | 0820-PVT11163| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pT7- His- TNF | 0820-PVT10122| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pT3-EF1a-NICD1-m | 0820-PVT17623| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pSilent- 1 Plasmid | 0820-PVT5309| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSETC, 2 ug | 0820-PVT0815| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSETB, 2 UG | 0820-PVT11609| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSETB Plasmid, 2 ug | 0820-PVT0814| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSET6A, 2 ug | 0820-PVT10612| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSET C, 2 ug | 0820-PVTY01162| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSET B, 2 ug | 0820-PVTY01161| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRSET A, 2 ug | 0820-PVTY01160| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRS426 | 0820-PVT4047| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRK5 Plasmid, 2 ug | 0820-PVT48959| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRI101-AN, 2 ug | 0820-PVT11185| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRGEB32, 2 ug | 0820-PVT11209| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pREP4 Plasmid, 2 ug | 0820-PVT5708| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pRE112 Plasmid, 2 ug | 0820-PVT6020| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pQE- TriSystem, 2 ug | 0820-PVT0544| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pProEX HTA plasmid | 0820-PVT0373| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pPR3- N plasmid | 0820-PVT11260| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pOTB7- 2ug (Lyophilized powder) | 0820-pOTB7-CUST| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pOET1.1C_6xHis transfer plasmid | 0514-2001012| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pOET1.1 Transfer Plasmid | 0514-200101| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pNZ8148 Plasmid, 2 ug | 0820-PVT5205| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pNZ8048 | 0820-PVT5204| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMito.iGABASnFR 2 ug | 0820-PVT39758| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMal- c5X Plasmid 2ug | 0820-PVT0409| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMaCTag-P05 | 0820-PVT18000| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMIGR1-smURFP-murine-Rela-m-p65 2ug | 0820-PVT27330| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMIGR1-SmurFP-ReLa-m-PL5 2ug | 0820-PVT14494| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMET А | 0820-PVTY00803| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMES4 Plasmid, 2 ug | 0820- PVT15975| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMC.EF1-MCS-SV40polyA | 0322-MN502A-1| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pMAL-c5X 2ug | 0820-PVTY00501| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

pLVX-EF1?-IRES-EGFP-PGK-Puro, 2 ug | 0820-PVT11071| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.