Chemicals

G-1-GPR30 agonist, potent and selective-10mg | 0607-B5455| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fura-2, pentasodium salt | 0271-21026-1mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fura-2, AM Ester | 0037-50034| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fura Red, potassium salt 1mg | 0271-21045-1mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Forsythoside B (CAS# 81525-13-5) | 0804-HY-N0029-10MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Forskolin, >99% | 0111-F9929-50MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Formononetin | 0804-HY-N0183-5mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

ForMax™AMCA Avidin-D (Deglycosylated) | 0468-21760038-1| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Folic acid (CAS N° 59-30-3) | 0931-T0062| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Folic acid (CAS No 59-30-3) | 0926-FF02403-1KG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Folate-PEG2-amine ( Cas N°1099829-15-8) | 0931-T38492-100MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fluorescein Active Caspase-3 Staining Kit | 0607-K2049-100| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Firsocostat (CAS No. : 1434635-54-7; Purity : 99.96%)- 25mg | 0804-HY-16901| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Finerenone (Synonyms: BAY 94-8862)-25 mg | 0804-HY-111372-25 mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Filipin 25mg | 0543-F020-25MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Filariasis IgG/IgM Rapid Test Cassette | 0920-FIL-302| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Filariasis IgG/IgM Rapid Test Cassette (WB/S / P) | 0920-IFIL-402| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fibronectin Coating Solution | 0171-TM059| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ferrostatin-1 (Fer-1) Ferroptosis inhibitor, erastin-induced 5mg | 0607-A4371-5m| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ferrocene NHS Ester (Amine Reactive Electrochemical Reporter: No. HPT1002) | 0605-HPT1002-0005| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ferrocene NHS Ester (Amine Reactive Electrochemical Reporter: No. HPT1002) | 0605-HPT1002-0700| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fentanyl-KLH conjugate 1mg | 0271-50567-1mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Falcon® 5 mL Round Bottom Polystyrene Test Tube, without Cap, Nonsterile, 1000/Bag, 1000/Case | SLS-352008| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FOXP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human) | 0171-20799111| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FMOC-Lys(Cy5)-OH-100mg | 0271-5055-100mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FLICA® 660 Caspase-1 Assay Kit | 0246-9122| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FK 506 100mg | 0111-F-4900-100mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC-PEG-OH, 2K 100mg | 0695-FL044002-2K-100mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC-PEG-OH, 10K 100mg | 0695-FL044002-10K-100mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC-PEG-NH2- 100 mg | 0695-FL044005-1K| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC-PEG-ACA, 2K 100mg | 0695-FL044010-2K| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC-PEG-AC, 2K 100mg | 0695-FL044009-2K| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC Conjugated Glycine max Lectin (Soybean) -SBA-, 2mg | 0235-F-1301-2| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-, 2mg | 0235-F-5701-2| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-, 1mg | 0235-F-4901-1| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC CONJUGATED AMARANTHUS CAUDATUS LECTIN (TASSEL FLOWER, INCA WHEAT) -ACA-, 2MG | 0235-F-8201-2| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLIVO® In vivo Poly Caspase Assay | 0246-981| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 9 Assay Kit | 0246-912| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 9 Assay Kit | 0246-913| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 8 Assay Kit | 0246-99| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 8 Assay Kit | 0246-910| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 3 & 7 Assay Kit | 0246-93| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 1 YVAD Assay Kit | 0246-97| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA® Caspase 1 YVAD Assay Kit | 0246-98| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA Caspase 1 WEHD Assay Kit | 0544-MBS258414| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA Caspase 1 WEHD Assay Kit | 0544-MBS258414-100T| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA Caspase 1 Assay Kit | 0544-MBS258406-25T| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM-FLICA Caspase 1 Assay Kit | 0544-MBS258406-100| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FAM FLICA Caspase-1 Assay Kit | 1106-ICT-98| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ezatiostat hydrochloride | 0628-A21222-5mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Evobrutinib | 0804-HY-101215| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Euonymus europaeus (EEL/EEA) (TRITC (Rhodamine)) | 1058-518355| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethynyl Estradiol 3-β-D-Glucuronide (hydrate) | 0931-T36917-1mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethyl 2-thio-β-D-fructofuranoside (CAS N° 80763-61-7) | 0862-GC2672-100MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethyl 1-Thio-β-D-glucuronide 250mg | 0572-E926805-250mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethidium Homodimer III (EthD-III) | 0037-40050| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Estrogen receptor α (ERα) ligand, 10 mg | 0607-B7481-10MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Escitalopram 50mg (128196-01-0) | 0024-sc-357349A -50mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Erlotinib Hydrochloride (CAS# 183319-69-9) | 0804-HY-12008-10G| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Epstein-Barr Virus (EBV) Lysate (1 mg) | 0002-0810008| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Eprenetapopt (CAS N° 5291-32-7 ; Purity: 99.57%) | 0931-T4414-5MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Epoxomicin | 0607-A2606-5| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Epoxomicin (proteasome inhibitor) | 0607-A2606-1MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Epipregnanolone, 100 mg | 0024-sc-­497491| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Enhanced Streptavidin poly-HRP | 0132-4740| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Enclomiphene citrate (CAS# 7599-79-3), Purity: 99.96% | 0804-HY-118861A-5MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Enclomiphene (citrate) (98%) | 0804-HY-118861A| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Encainide HCl | 0628-A13898-10 mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Emodinanthrone | 0931-TN6740-5mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Embedding Paraffin Wax /56-58°C, 10X1KG | 0671-8002-74-2| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Eliglustat (Genz 99067), Purity >99% | 0804-HY-14885-500MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Elamipretide | 0804-HY-P0125-5mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Elamipretide | 0804-HY-P0125-10mg| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ebola virus-like particles (EBOV VLP) | 0494-0550-001| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

EZ Cap™ mCherry mRNA (m1Ψ) | 0607-R1047| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

EZ Cap™ mCherry mRNA (5mCTP, ψUTP) | 0607-R1017-1MG| Gentaur Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

E-64 Cysteine protease inhibitor, irriversible | 0607-A2576-5mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

E-64 Cysteine protease inhibitor, irriversible | 0607-A2576-25mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Drosophila Total RNA -0.025mg | 0062-DPR-290 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dorzolamide Maleic Acid Adduct 25mg | 0572-TRC-D535105-25MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dorsomorphin dihydrochloride | 0804-HY-13418-10MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dorsomorphin 2HCl; 99.57%, 10mg | 0607-B1372-10 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dolichos biflorus Lectin, 5 mg | 0544-MBS656409 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dolichos biflorus Lectin (DBA) | 0468-21510044-1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dog Liver RNA, 0.1mg | 0062-DR-314 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Docetaxel, >99% (CAS# 114977-28-5) | 0111-D-1000-250mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Diptheria Toxin-Vaccine Adjuvant | 0494-1601-001 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Digoxin-d3 | 0544-MBS6071351-2.5MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dicoumarol | 0607-B4785 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dibutyryl-cAMP, sodium salt | 0544-B9001-50mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiagNano™ Water Dispersible Upconverting Nanoparticles, 804 nm | 0875-DNL-B010 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Diacetylated Monoglycerides Chemical Reference -200mg | 0544-MBS539946-5x200MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiR-10mg | 0037-60017-10mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiOC6(3) iodide [3, 3-Dihexyloxacarbocyanine iodide] | 0271-22046-25mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiOC3(3) iodide [3, 3-Dipropyloxacarbocyanine iodide]-25mg | 0271-22039 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiIC18(3)-DS [1, 1-Dioctadecyl-3, 3, 3, 3-tetramethylindocarbocyanine-5, 5-disulfonic acid] | 0271-22052 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiD-10mg | 0037-60014-10mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DiBAC4(3) [Bis-(1, 3-dibutylbarbituric acid)trimethine oxonol] | 0271-21411 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Dexmedetomidine(Purity 98%), 50 mg | 0804-HY-12719 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.