Chemicals

Chemicals

  • Product
  • Qty in Cart
  • Quantity
  • Price
  • Subtotal
  • Bestatin

    Bestatin | 0607-A2575-10mg

    €406.00
    Bestatin | 0607-A2575-10mg| Gentaur Distribution US, UK & Europe This Bestatin | 0607-A2575-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €406.00
    Quick view
    Qty in Cart: 0
    Price:
    €406.00
    Subtotal:
  • Bentazepam

    Bentazepam | 0926-EBA46218-100

    €870.00
    Bentazepam | 0926-EBA46218-100| Gentaur Distribution US, UK & Europe This Bentazepam | 0926-EBA46218-100 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €870.00
    Quick view
    Qty in Cart: 0
    Price:
    €870.00
    Subtotal:
  • Bauhinia purpurea Lectin (BPL/BPA)

    Bauhinia purpurea Lectin (BPL/BPA) | 0468-21510028-1

    €311.00
    Bauhinia purpurea Lectin (BPL/BPA) | 0468-21510028-1| Gentaur Distribution US, UK & Europe This Bauhinia purpurea Lectin (BPL/BPA) | 0468-21510028-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €311.00
    Quick view
    Qty in Cart: 0
    Price:
    €311.00
    Subtotal:
  • Base Holders package of 10 with cases

    Base Holders package of 10 with cases | 0414-BH-10

    €220.00
    Base Holders package of 10 with cases | 0414-BH-10| Gentaur Distribution US, UK & Europe This Base Holders package of 10 with cases | 0414-BH-10 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €220.00
    Quick view
    Qty in Cart: 0
    Price:
    €220.00
    Subtotal:
  • Barium Nitrite CAS 13465-94-6

    Barium Nitrite CAS 13465-94-6 | 0983-ING0002443-1KG

    €1,070.00
    Barium Nitrite CAS 13465-94-6 | 0983-ING0002443-1KG| Gentaur Distribution US, UK & Europe This Barium Nitrite CAS 13465-94-6 | 0983-ING0002443-1KG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €1,070.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,070.00
    Subtotal:
  • Baicalin

    Baicalin | 0628-A10121-100mg

    €350.00
    Baicalin | 0628-A10121-100mg| Gentaur Distribution US, UK & Europe This Baicalin | 0628-A10121-100mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €350.00
    Quick view
    Qty in Cart: 0
    Price:
    €350.00
    Subtotal:
  • Bafilomycin A1

    Bafilomycin A1 | 0607-A8627-1mg

    €570.00
    Bafilomycin A1 | 0607-A8627-1mg| Gentaur Distribution US, UK & Europe This Bafilomycin A1 | 0607-A8627-1mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €570.00
    Quick view
    Qty in Cart: 0
    Price:
    €570.00
    Subtotal:
  • Background buster (Ready-To-Use)

    Background buster (Ready-To-Use) | 0408-NB306-50

    €590.00
    Background buster (Ready-To-Use) | 0408-NB306-50| Gentaur Distribution US, UK & Europe This Background buster (Ready-To-Use) | 0408-NB306-50 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €590.00
    Quick view
    Qty in Cart: 0
    Price:
    €590.00
    Subtotal:
  • Background buster (Ready-To-Use)

    Background buster (Ready-To-Use) | 0408-NB306

    €788.00
    Background buster (Ready-To-Use) | 0408-NB306| Gentaur Distribution US, UK & Europe This Background buster (Ready-To-Use) | 0408-NB306 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €788.00
    Quick view
    Qty in Cart: 0
    Price:
    €788.00
    Subtotal:
  • Background Buster, 7 ml (trial size); Ready-To-Use

    Background Buster, 7 ml (trial size); Ready-To-Use | 0408-NB306-7

    €375.00
    Background Buster, 7 ml (trial size); Ready-To-Use | 0408-NB306-7| Gentaur Distribution US, UK & Europe This Background Buster, 7 ml (trial size); Ready-To-Use | 0408-NB306-7 is guaranteed Product with the use of CMV and directly supplied to your...
    €375.00
    Quick view
    Qty in Cart: 0
    Price:
    €375.00
    Subtotal:
  • BTC, AM (CAS 176767-94-5)

    BTC, AM (CAS 176767-94-5) | 0271-21054

    €401.00
    BTC, AM (CAS 176767-94-5) | 0271-21054| Gentaur Distribution US, UK & Europe This BTC, AM (CAS 176767-94-5) | 0271-21054 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €401.00
    Quick view
    Qty in Cart: 0
    Price:
    €401.00
    Subtotal:
  • BSA conjugated Abscisic acid

    BSA conjugated Abscisic acid | 0399-CSB-MC00421B0105-1MG

    €544.00
    BSA conjugated Abscisic acid | 0399-CSB-MC00421B0105-1MG| Gentaur Distribution US, UK & Europe This BSA conjugated Abscisic acid | 0399-CSB-MC00421B0105-1MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €544.00
    Quick view
    Qty in Cart: 0
    Price:
    €544.00
    Subtotal:
  • BRM961b : Breast carcinoma with matched regional lymph nodes metastasis carcinoma or breast tissue array, including TNM/Stage (AJCC 8th edition), pathology grade and IHC marker ER/PR/Her-2 results, 48 cases/96 cores (core size 1.5mm),

    BRM961b : Breast carcinoma with matched regional lymph nodes metastasis carcinoma or breast tissue array, including TNM/Stage (AJCC 8th edition), pathology grade and IHC marker ER/PR/Her-2 results, 48 cases/96 cores (core size 1.5mm), | 0131-BRM961b

    €556.00
    BRM961b : Breast carcinoma with matched regional lymph nodes metastasis carcinoma or breast tissue array, including TNM/Stage (AJCC 8th edition), pathology grade and IHC marker ER/PR/Her-2 results, 48 cases/96 cores (core size 1.5mm), | 0131-BRM961b|...
    €556.00
    Quick view
    Qty in Cart: 0
    Price:
    €556.00
    Subtotal:
  • BR20837a : Breast cancer and matched metastatic carcinoma tissue array, including TNM, clinical stage and pathology grade, 104 cases/ 208 cores, replacing BR20837

    BR20837a : Breast cancer and matched metastatic carcinoma tissue array, including TNM, clinical stage and pathology grade, 104 cases/ 208 cores, replacing BR20837 | 0131-BR20837a

    €726.00
    BR20837a : Breast cancer and matched metastatic carcinoma tissue array, including TNM, clinical stage and pathology grade, 104 cases/ 208 cores, replacing BR20837 | 0131-BR20837a| Gentaur Distribution US, UK & Europe This BR20837a : Breast cancer...
    €726.00
    Quick view
    Qty in Cart: 0
    Price:
    €726.00
    Subtotal:
  • BPE (Bovine Pituitary Extract)

    BPE (Bovine Pituitary Extract) | 0016-0414

    €1,125.00
    BPE (Bovine Pituitary Extract) | 0016-0414| Gentaur Distribution US, UK & Europe This BPE (Bovine Pituitary Extract) | 0016-0414 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €1,125.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,125.00
    Subtotal:
  • BPC 157 (Cas No. 137525-51-0)

    BPC 157 (Cas No. 137525-51-0) | 0931-T20561

    €346.00
    BPC 157 (Cas No. 137525-51-0) | 0931-T20561| Gentaur Distribution US, UK & Europe This BPC 157 (Cas No. 137525-51-0) | 0931-T20561 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €346.00
    Quick view
    Qty in Cart: 0
    Price:
    €346.00
    Subtotal:
  • BMPS (CAS N°55750-62-4 )

    BMPS (CAS N°55750-62-4 ) | 0931-T14668-500MG

    €216.00
    BMPS (CAS N°55750-62-4 ) | 0931-T14668-500MG| Gentaur Distribution US, UK & Europe This BMPS (CAS N°55750-62-4 ) | 0931-T14668-500MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €216.00
    Quick view
    Qty in Cart: 0
    Price:
    €216.00
    Subtotal:
  • BMP-22 (CAS N°1306684-90-1)

    BMP-22 (CAS N°1306684-90-1) | 0931-T36138-50MG

    €1,882.00
    BMP-22 (CAS N°1306684-90-1) | 0931-T36138-50MG| Gentaur Distribution US, UK & Europe This BMP-22 (CAS N°1306684-90-1) | 0931-T36138-50MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €1,882.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,882.00
    Subtotal:
  • BMP-22 (CAS N°1306684-90-1)

    BMP-22 (CAS N°1306684-90-1) | 0931-T36138-5MG

    €973.00
    BMP-22 (CAS N°1306684-90-1) | 0931-T36138-5MG| Gentaur Distribution US, UK & Europe This BMP-22 (CAS N°1306684-90-1) | 0931-T36138-5MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €973.00
    Quick view
    Qty in Cart: 0
    Price:
    €973.00
    Subtotal:
  • BMP-22 (CAS N°1306684-90-1)

    BMP-22 (CAS N°1306684-90-1) | 0931-T36138-100MG

    €2,350.00
    BMP-22 (CAS N°1306684-90-1) | 0931-T36138-100MG| Gentaur Distribution US, UK & Europe This BMP-22 (CAS N°1306684-90-1) | 0931-T36138-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €2,350.00
    Quick view
    Qty in Cart: 0
    Price:
    €2,350.00
    Subtotal:
  • BMP signaling agonist sb4 (CAS N° 100874-08-6)

    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-50MG

    €216.00
    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-50MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-50MG is guaranteed Product with the use of CMV and directly supplied to your...
    €216.00
    Quick view
    Qty in Cart: 0
    Price:
    €216.00
    Subtotal:
  • BMP signaling agonist sb4 (CAS N° 100874-08-6)

    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-5MG

    €135.00
    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-5MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-5MG is guaranteed Product with the use of CMV and directly supplied to your lab...
    €135.00
    Quick view
    Qty in Cart: 0
    Price:
    €135.00
    Subtotal:
  • BMP signaling agonist sb4 (CAS N° 100874-08-6)

    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-25MG

    €181.00
    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-25MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-25MG is guaranteed Product with the use of CMV and directly supplied to your...
    €181.00
    Quick view
    Qty in Cart: 0
    Price:
    €181.00
    Subtotal:
  • BMP signaling agonist sb4 (CAS N° 100874-08-6)

    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-200MG

    €368.00
    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-200MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-200MG is guaranteed Product with the use of CMV and directly supplied to your...
    €368.00
    Quick view
    Qty in Cart: 0
    Price:
    €368.00
    Subtotal:
  • BMP signaling agonist sb4 (CAS N° 100874-08-6)

    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-100MG

    €278.00
    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-100MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-100MG is guaranteed Product with the use of CMV and directly supplied to your...
    €278.00
    Quick view
    Qty in Cart: 0
    Price:
    €278.00
    Subtotal:
  • BMP signaling agonist sb4 (CAS N° 100874-08-6)

    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-10MG

    €150.00
    BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-10MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-10MG is guaranteed Product with the use of CMV and directly supplied to your...
    €150.00
    Quick view
    Qty in Cart: 0
    Price:
    €150.00
    Subtotal:
  • BIOPHEN CS-01(81)

    BIOPHEN CS-01(81) | 0735-229005

    €780.00
    BIOPHEN CS-01(81) | 0735-229005| Gentaur Distribution US, UK & Europe This BIOPHEN CS-01(81) | 0735-229005 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €780.00
    Quick view
    Qty in Cart: 0
    Price:
    €780.00
    Subtotal:
  • BIC14011b : Pancreas intraepithelial neoplasia(PanIN), pancreatitis and cancer tissue array, including pathology grade, TNM and clinical stage, 24 cases/48 cores, replacing BIC14011a

    BIC14011b : Pancreas intraepithelial neoplasia(PanIN), pancreatitis and cancer tissue array, including pathology grade, TNM and clinical stage, 24 cases/48 cores, replacing BIC14011a | 0131-BIC14011b

    €325.00
    BIC14011b : Pancreas intraepithelial neoplasia(PanIN), pancreatitis and cancer tissue array, including pathology grade, TNM and clinical stage, 24 cases/48 cores, replacing BIC14011a | 0131-BIC14011b| Gentaur Distribution US, UK & Europe This...
    €325.00
    Quick view
    Qty in Cart: 0
    Price:
    €325.00
    Subtotal:
  • Avibactam

    Avibactam | 0628-A11299-25mg

    €1,780.00
    Avibactam | 0628-A11299-25mg| Gentaur Distribution US, UK & Europe This Avibactam | 0628-A11299-25mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €1,780.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,780.00
    Subtotal:
  • Astragaloside IV

    Astragaloside IV | 0804-HY-N0431-10mg

    €165.00
    Astragaloside IV | 0804-HY-N0431-10mg| Gentaur Distribution US, UK & Europe This Astragaloside IV | 0804-HY-N0431-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €165.00
    Quick view
    Qty in Cart: 0
    Price:
    €165.00
    Subtotal:
  • Astragaloside III

    Astragaloside III | 0804-HY-N0434-5mg

    €240.00
    Astragaloside III | 0804-HY-N0434-5mg| Gentaur Distribution US, UK & Europe This Astragaloside III | 0804-HY-N0434-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €240.00
    Quick view
    Qty in Cart: 0
    Price:
    €240.00
    Subtotal:
  • Astragaloside II

    Astragaloside II | 0804-HY-N0433-10mg

    €280.00
    Astragaloside II | 0804-HY-N0433-10mg| Gentaur Distribution US, UK & Europe This Astragaloside II | 0804-HY-N0433-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €280.00
    Quick view
    Qty in Cart: 0
    Price:
    €280.00
    Subtotal:
  • Astragaloside I

    Astragaloside I | 0804-HY-N0432-10mg

    €200.00
    Astragaloside I | 0804-HY-N0432-10mg| Gentaur Distribution US, UK & Europe This Astragaloside I | 0804-HY-N0432-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €200.00
    Quick view
    Qty in Cart: 0
    Price:
    €200.00
    Subtotal:
  • Artesunate ( CAS N°88495-63-0)

    Artesunate ( CAS N°88495-63-0) | 0862-GA7503-10MG

    €70.00
    Artesunate ( CAS N°88495-63-0) | 0862-GA7503-10MG| Gentaur Distribution US, UK & Europe This Artesunate ( CAS N°88495-63-0) | 0862-GA7503-10MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €70.00
    Quick view
    Qty in Cart: 0
    Price:
    €70.00
    Subtotal:
  • Arachis hypogaea Lectin (PNA)

    Arachis hypogaea Lectin (PNA) | 0468-21510927-1

    €346.00
    Arachis hypogaea Lectin (PNA) | 0468-21510927-1| Gentaur Distribution US, UK & Europe This Arachis hypogaea Lectin (PNA) | 0468-21510927-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €346.00
    Quick view
    Qty in Cart: 0
    Price:
    €346.00
    Subtotal:
  • Arachis hypogaea Lectin (PNA)

    Arachis hypogaea Lectin (PNA) | 0468-21761089-1

    €448.00
    Arachis hypogaea Lectin (PNA) | 0468-21761089-1| Gentaur Distribution US, UK & Europe This Arachis hypogaea Lectin (PNA) | 0468-21761089-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €448.00
    Quick view
    Qty in Cart: 0
    Price:
    €448.00
    Subtotal:
  • Arachis hypogaea (Peanut) Lectin (PNA)

    Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-1

    €3,746.00
    Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-1| Gentaur Distribution US, UK & Europe This Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €3,746.00
    Quick view
    Qty in Cart: 0
    Price:
    €3,746.00
    Subtotal:
  • Arachis hypogaea (Peanut) Lectin (PNA)

    Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-5

    €524.00
    Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-5| Gentaur Distribution US, UK & Europe This Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €524.00
    Quick view
    Qty in Cart: 0
    Price:
    €524.00
    Subtotal:
  • Arabinoxylan 98%. Food grade. 1kg // MOQ 1kg

    Arabinoxylan 98%. Food grade. 1kg // MOQ 1kg | 0731-EXTZ-463-1kg

    €9,775.00
    Arabinoxylan 98%. Food grade. 1kg // MOQ 1kg | 0731-EXTZ-463-1kg| Gentaur Distribution US, UK & Europe This Arabinoxylan 98%. Food grade. 1kg // MOQ 1kg | 0731-EXTZ-463-1kg is guaranteed Product with the use of CMV and directly supplied to your...
    €9,775.00
    Quick view
    Qty in Cart: 0
    Price:
    €9,775.00
    Subtotal:
  • Arabinogalactans 99% 1kg // MOQ:1KG

    Arabinogalactans 99% 1kg // MOQ:1KG | 0731-CEFX-081-1kg

    €456.00
    Arabinogalactans 99% 1kg // MOQ:1KG | 0731-CEFX-081-1kg| Gentaur Distribution US, UK & Europe This Arabinogalactans 99% 1kg // MOQ:1KG | 0731-CEFX-081-1kg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €456.00
    Quick view
    Qty in Cart: 0
    Price:
    €456.00
    Subtotal:
  • Apple Pectin Powder. 100kg // MOQ:100kg.

    Apple Pectin Powder. 100kg // MOQ:100kg. | 0731-APPC-100-100kg

    €27,075.00
    Apple Pectin Powder. 100kg // MOQ:100kg. | 0731-APPC-100-100kg| Gentaur Distribution US, UK & Europe This Apple Pectin Powder. 100kg // MOQ:100kg. | 0731-APPC-100-100kg is guaranteed Product with the use of CMV and directly supplied to your lab by...
    €27,075.00
    Quick view
    Qty in Cart: 0
    Price:
    €27,075.00
    Subtotal:
  • Anthopleurin-A- (Cas No : 60880-63-9)- 0.1 mg

    Anthopleurin-A- (Cas No : 60880-63-9)- 0.1 mg | 0121-4030365

    €368.00
    Anthopleurin-A- (Cas No : 60880-63-9)- 0.1 mg | 0121-4030365| Gentaur Distribution US, UK & Europe This Anthopleurin-A- (Cas No : 60880-63-9)- 0.1 mg | 0121-4030365 is guaranteed Product with the use of CMV and directly supplied to your lab by...
    €368.00
    Quick view
    Qty in Cart: 0
    Price:
    €368.00
    Subtotal:
  • Angiotensin 1/2 (1-9)

    Angiotensin 1/2 (1-9) | 0607-A1007-10mg

    €15,301.00
    Angiotensin 1/2 (1-9) | 0607-A1007-10mg| Gentaur Distribution US, UK & Europe This Angiotensin 1/2 (1-9) | 0607-A1007-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €15,301.00
    Quick view
    Qty in Cart: 0
    Price:
    €15,301.00
    Subtotal:
  • Angiotensin 1/2 (1-9)

    Angiotensin 1/2 (1-9) | 0607-A10007-10mg

    €15,287.00
    Angiotensin 1/2 (1-9) | 0607-A10007-10mg| Gentaur Distribution US, UK & Europe This Angiotensin 1/2 (1-9) | 0607-A10007-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €15,287.00
    Quick view
    Qty in Cart: 0
    Price:
    €15,287.00
    Subtotal:
  • Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95%

    Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg

    €930.00
    Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg| Gentaur Distribution US, UK & Europe This Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1...
    €930.00
    Quick view
    Qty in Cart: 0
    Price:
    €930.00
    Subtotal:
  • Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95%

    Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg

    €795.00
    Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg| Gentaur Distribution US, UK & Europe This Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1...
    €795.00
    Quick view
    Qty in Cart: 0
    Price:
    €795.00
    Subtotal:
  • Ampicillin Trihydrate, EP, 1 kg

    Ampicillin Trihydrate, EP, 1 kg | 0543-A020-1KG/C

    €3,042.00
    Ampicillin Trihydrate, EP, 1 kg | 0543-A020-1KG/C| Gentaur Distribution US, UK & Europe This Ampicillin Trihydrate, EP, 1 kg | 0543-A020-1KG/C is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €3,042.00
    Quick view
    Qty in Cart: 0
    Price:
    €3,042.00
    Subtotal:
  • Amphotericin B

    Amphotericin B | 0862-GA8986-100mg

    €350.00
    Amphotericin B | 0862-GA8986-100mg| Gentaur Distribution US, UK & Europe This Amphotericin B | 0862-GA8986-100mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €350.00
    Quick view
    Qty in Cart: 0
    Price:
    €350.00
    Subtotal:
  • Amphetamine-d11

    Amphetamine-d11 | 0572-A634251

    €12,331.00
    Amphetamine-d11 | 0572-A634251| Gentaur Distribution US, UK & Europe This Amphetamine-d11 | 0572-A634251 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €12,331.00
    Quick view
    Qty in Cart: 0
    Price:
    €12,331.00
    Subtotal:
  • Amoxicillin Trihydrate, 1 Kg

    Amoxicillin Trihydrate, 1 Kg | 0543-A004-1KG/C

    €3,350.00
    Amoxicillin Trihydrate, 1 Kg | 0543-A004-1KG/C| Gentaur Distribution US, UK & Europe This Amoxicillin Trihydrate, 1 Kg | 0543-A004-1KG/C is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €3,350.00
    Quick view
    Qty in Cart: 0
    Price:
    €3,350.00
    Subtotal:
  • Alpha-Tocopherol-d6 Acetate (CAS N°143731-16-2)

    Alpha-Tocopherol-d6 Acetate (CAS N°143731-16-2) | 0572-TRC-T526117-10MG

    €4,120.00
    Alpha-Tocopherol-d6 Acetate (CAS N°143731-16-2) | 0572-TRC-T526117-10MG| Gentaur Distribution US, UK & Europe This Alpha-Tocopherol-d6 Acetate (CAS N°143731-16-2) | 0572-TRC-T526117-10MG is guaranteed Product with the use of CMV and directly...
    €4,120.00
    Quick view
    Qty in Cart: 0
    Price:
    €4,120.00
    Subtotal:
  • Alpha Synuclein Pre-formed Fibrils (Type 1)

    Alpha Synuclein Pre-formed Fibrils (Type 1) | 0400-SPR-322XE-500UG

    €1,602.00
    Alpha Synuclein Pre-formed Fibrils (Type 1) | 0400-SPR-322XE-500UG| Gentaur Distribution US, UK & Europe This Alpha Synuclein Pre-formed Fibrils (Type 1) | 0400-SPR-322XE-500UG is guaranteed Product with the use of CMV and directly supplied to...
    €1,602.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,602.00
    Subtotal:
  • Alpelisib (CAS# 1217486-61-7)

    Alpelisib (CAS# 1217486-61-7) | 0804-HY-15244-1G

    €2,000.00
    Alpelisib (CAS# 1217486-61-7) | 0804-HY-15244-1G| Gentaur Distribution US, UK & Europe This Alpelisib (CAS# 1217486-61-7) | 0804-HY-15244-1G is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €2,000.00
    Quick view
    Qty in Cart: 0
    Price:
    €2,000.00
    Subtotal:
  • Allium sativum Lectin (ASA)

    Allium sativum Lectin (ASA) | 0468-21510978-1

    €471.00
    Allium sativum Lectin (ASA) | 0468-21510978-1| Gentaur Distribution US, UK & Europe This Allium sativum Lectin (ASA) | 0468-21510978-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €471.00
    Quick view
    Qty in Cart: 0
    Price:
    €471.00
    Subtotal:
  • Agarose, Molecular Biology Grade, 1kg

    Agarose, Molecular Biology Grade, 1kg | 0304-PC0701-1kg

    €919.00
    Agarose, Molecular Biology Grade, 1kg | 0304-PC0701-1kg| Gentaur Distribution US, UK & Europe This Agarose, Molecular Biology Grade, 1kg | 0304-PC0701-1kg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €919.00
    Quick view
    Qty in Cart: 0
    Price:
    €919.00
    Subtotal:
  • Agaricus bisporus Lectin (ABA/ABL)

    Agaricus bisporus Lectin (ABA/ABL) | 0468-21510154-1

    €339.00
    Agaricus bisporus Lectin (ABA/ABL) | 0468-21510154-1| Gentaur Distribution US, UK & Europe This Agaricus bisporus Lectin (ABA/ABL) | 0468-21510154-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €339.00
    Quick view
    Qty in Cart: 0
    Price:
    €339.00
    Subtotal:
  • Adalimumab Biosimilar (Research Grade)

    Adalimumab Biosimilar (Research Grade) | 0879-KBIY400-5MG

    €1,389.00
    Adalimumab Biosimilar (Research Grade) | 0879-KBIY400-5MG| Gentaur Distribution US, UK & Europe This Adalimumab Biosimilar (Research Grade) | 0879-KBIY400-5MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €1,389.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,389.00
    Subtotal:
  • Actinomycin D (CAS N°50-76-0)- 10 mg

    Actinomycin D (CAS N°50-76-0)- 10 mg | 0862-GA0481-10MG

    €90.00
    Actinomycin D (CAS N°50-76-0)- 10 mg | 0862-GA0481-10MG| Gentaur Distribution US, UK & Europe This Actinomycin D (CAS N°50-76-0)- 10 mg | 0862-GA0481-10MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €90.00
    Quick view
    Qty in Cart: 0
    Price:
    €90.00
    Subtotal:
  • Acetyl tetrapeptide-3 Acetate

    Acetyl tetrapeptide-3 Acetate | 0931-TP2364L

    €560.00
    Acetyl tetrapeptide-3 Acetate | 0931-TP2364L| Gentaur Distribution US, UK & Europe This Acetyl tetrapeptide-3 Acetate | 0931-TP2364L is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €560.00
    Quick view
    Qty in Cart: 0
    Price:
    €560.00
    Subtotal:
  • Acetamiprid (Purity: >99.8%)

    Acetamiprid (Purity: >99.8%) | 0804-HY-B0823-100MG

    €212.00
    Acetamiprid (Purity: >99.8%) | 0804-HY-B0823-100MG| Gentaur Distribution US, UK & Europe This Acetamiprid (Purity: >99.8%) | 0804-HY-B0823-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €212.00
    Quick view
    Qty in Cart: 0
    Price:
    €212.00
    Subtotal:
  • Accu-Tell® Typhoid Cassette (Serum/Plasma)

    Accu-Tell® Typhoid Cassette (Serum/Plasma) | 0826-ABT-IDT-B263

    €69.00
    Accu-Tell® Typhoid Cassette (Serum/Plasma) | 0826-ABT-IDT-B263| Gentaur Distribution US, UK & Europe This Accu-Tell® Typhoid Cassette (Serum/Plasma) | 0826-ABT-IDT-B263 is guaranteed Product with the use of CMV and directly supplied to your lab by...
    €69.00
    Quick view
    Qty in Cart: 0
    Price:
    €69.00
    Subtotal:
  • Accu-Tell® Strep A Cassette (Throat Swab)

    Accu-Tell® Strep A Cassette (Throat Swab) | 0826-ABT-IDT-B15

    €71.00
    Accu-Tell® Strep A Cassette (Throat Swab) | 0826-ABT-IDT-B15| Gentaur Distribution US, UK & Europe This Accu-Tell® Strep A Cassette (Throat Swab) | 0826-ABT-IDT-B15 is guaranteed Product with the use of CMV and directly supplied to your lab by...
    €71.00
    Quick view
    Qty in Cart: 0
    Price:
    €71.00
    Subtotal:
  • AY 9944(Purity 98%)

    AY 9944(Purity 98%) | 0804-HY-107420-5mg

    €276.00
    AY 9944(Purity 98%) | 0804-HY-107420-5mg| Gentaur Distribution US, UK & Europe This AY 9944(Purity 98%) | 0804-HY-107420-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €276.00
    Quick view
    Qty in Cart: 0
    Price:
    €276.00
    Subtotal:
  • AY 9944 dihydrochloride

    AY 9944 dihydrochloride | 0607-A8658-5mg

    €423.00
    AY 9944 dihydrochloride | 0607-A8658-5mg| Gentaur Distribution US, UK & Europe This AY 9944 dihydrochloride | 0607-A8658-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €423.00
    Quick view
    Qty in Cart: 0
    Price:
    €423.00
    Subtotal:
  • ATTO 488 NHS ester

    ATTO 488 NHS ester | 0271-2815

    €250.00
    ATTO 488 NHS ester | 0271-2815| Gentaur Distribution US, UK & Europe This ATTO 488 NHS ester | 0271-2815 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €250.00
    Quick view
    Qty in Cart: 0
    Price:
    €250.00
    Subtotal:
  • ATPαS cas : 29220-54-0 -5 x 25µl (100 mM)

    ATPαS cas : 29220-54-0 -5 x 25µl (100 mM) | 0220-NU-408L

    €71,192.00
    ATPαS cas : 29220-54-0 -5 x 25µl (100 mM) | 0220-NU-408L| Gentaur Distribution US, UK & Europe This ATPαS cas : 29220-54-0 -5 x 25µl (100 mM) | 0220-NU-408L is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €71,192.00
    Quick view
    Qty in Cart: 0
    Price:
    €71,192.00
    Subtotal:
  • ASSY, PKGD, SMALL, BALL VALVE LOCKOUT"

    ASSY, PKGD, SMALL, BALL VALVE LOCKOUT" | 0079-121540

    €12,649.00
    ASSY, PKGD, SMALL, BALL VALVE LOCKOUT" | 0079-121540| Gentaur Distribution US, UK & Europe This ASSY, PKGD, SMALL, BALL VALVE LOCKOUT" | 0079-121540 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €12,649.00
    Quick view
    Qty in Cart: 0
    Price:
    €12,649.00
    Subtotal:
  • ARCA Cy5 EGFP mRNA (5-moUTP)

    ARCA Cy5 EGFP mRNA (5-moUTP) | 0607-R1009-100ug-(1mg/mL)

    €930.00
    ARCA Cy5 EGFP mRNA (5-moUTP) | 0607-R1009-100ug-(1mg/mL)| Gentaur Distribution US, UK & Europe This ARCA Cy5 EGFP mRNA (5-moUTP) | 0607-R1009-100ug-(1mg/mL) is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €930.00
    Quick view
    Qty in Cart: 0
    Price:
    €930.00
    Subtotal:
  • AICAR phosphate (CAS N°681006-28-0 ) Spec

    AICAR phosphate (CAS N°681006-28-0 ) Spec | 0931-T14149-50MG

    €283.00
    AICAR phosphate (CAS N°681006-28-0 ) Spec | 0931-T14149-50MG| Gentaur Distribution US, UK & Europe This AICAR phosphate (CAS N°681006-28-0 ) Spec | 0931-T14149-50MG is guaranteed Product with the use of CMV and directly supplied to your lab by...
    €283.00
    Quick view
    Qty in Cart: 0
    Price:
    €283.00
    Subtotal:
  • AICAR

    AICAR | 0607-A8184-200

    €276.00
    AICAR | 0607-A8184-200| Gentaur Distribution US, UK & Europe This AICAR | 0607-A8184-200 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €276.00
    Quick view
    Qty in Cart: 0
    Price:
    €276.00
    Subtotal:
  • AICAR (CAS No. : 2627-69-2)

    AICAR (CAS No. : 2627-69-2) | 0804-HY-13417

    €145.00
    AICAR (CAS No. : 2627-69-2) | 0804-HY-13417| Gentaur Distribution US, UK & Europe This AICAR (CAS No. : 2627-69-2) | 0804-HY-13417 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €145.00
    Quick view
    Qty in Cart: 0
    Price:
    €145.00
    Subtotal:
  • AE-6210-2 Slab Gel Cast, 2-mm 12-well

    AE-6210-2 Slab Gel Cast, 2-mm 12-well | 0245-2392981

    €835.00
    AE-6210-2 Slab Gel Cast, 2-mm 12-well | 0245-2392981| Gentaur Distribution US, UK & Europe This AE-6210-2 Slab Gel Cast, 2-mm 12-well | 0245-2392981 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €835.00
    Quick view
    Qty in Cart: 0
    Price:
    €835.00
    Subtotal:
  • ACETONE 99.9% GC GRADE (CAS N°67-64-1)

    ACETONE 99.9% GC GRADE (CAS N°67-64-1) | 0951-0013A

    €1.00
    ACETONE 99.9% GC GRADE (CAS N°67-64-1) | 0951-0013A| Gentaur Distribution US, UK & Europe This ACETONE 99.9% GC GRADE (CAS N°67-64-1) | 0951-0013A is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €1.00
    Quick view
    Qty in Cart: 0
    Price:
    €1.00
    Subtotal:
  • ABO and RhD Blood Grouping Rapid Test Cassette

    ABO and RhD Blood Grouping Rapid Test Cassette | 0920-OABD-402-25T

    €340.00
    ABO and RhD Blood Grouping Rapid Test Cassette | 0920-OABD-402-25T| Gentaur Distribution US, UK & Europe This ABO and RhD Blood Grouping Rapid Test Cassette | 0920-OABD-402-25T is guaranteed Product with the use of CMV and directly supplied to...
    €340.00
    Quick view
    Qty in Cart: 0
    Price:
    €340.00
    Subtotal:
  • AB-FUBINACA 2-Fluorobenzyl Isomer

    AB-FUBINACA 2-Fluorobenzyl Isomer | 0572-TRC-A112630-100MG

    €3,065.00
    AB-FUBINACA 2-Fluorobenzyl Isomer | 0572-TRC-A112630-100MG| Gentaur Distribution US, UK & Europe This AB-FUBINACA 2-Fluorobenzyl Isomer | 0572-TRC-A112630-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by...
    €3,065.00
    Quick view
    Qty in Cart: 0
    Price:
    €3,065.00
    Subtotal:
  • A5124-250 Meropenem (96036-03-2) 99.63%

    A5124-250 Meropenem (96036-03-2) 99.63% | 0607-A5124-250

    €416.00
    A5124-250 Meropenem (96036-03-2) 99.63% | 0607-A5124-250| Gentaur Distribution US, UK & Europe This A5124-250 Meropenem (96036-03-2) 99.63% | 0607-A5124-250 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €416.00
    Quick view
    Qty in Cart: 0
    Price:
    €416.00
    Subtotal:
  • A Dil w Background-Red Comp 125 mL

    A Dil w Background-Red Comp 125 mL | 0237-S302283-2

    €496.00
    A Dil w Background-Red Comp 125 mL | 0237-S302283-2| Gentaur Distribution US, UK & Europe This A Dil w Background-Red Comp 125 mL | 0237-S302283-2 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €496.00
    Quick view
    Qty in Cart: 0
    Price:
    €496.00
    Subtotal:
  • 68 kDa Neurofilament Ag (Bovine)

    68 kDa Neurofilament Ag (Bovine) | 0544-MBS537339-0.25MG

    €2,100.00
    68 kDa Neurofilament Ag (Bovine) | 0544-MBS537339-0.25MG| Gentaur Distribution US, UK & Europe This 68 kDa Neurofilament Ag (Bovine) | 0544-MBS537339-0.25MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €2,100.00
    Quick view
    Qty in Cart: 0
    Price:
    €2,100.00
    Subtotal:
  • 6-FAM Azide

    6-FAM Azide | 0271-955

    €960.00
    6-FAM Azide | 0271-955| Gentaur Distribution US, UK & Europe This 6-FAM Azide | 0271-955 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €960.00
    Quick view
    Qty in Cart: 0
    Price:
    €960.00
    Subtotal:
  • 6-FAM Azide

    6-FAM Azide | 0271-133

    €400.00
    6-FAM Azide | 0271-133| Gentaur Distribution US, UK & Europe This 6-FAM Azide | 0271-133 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €400.00
    Quick view
    Qty in Cart: 0
    Price:
    €400.00
    Subtotal:
  • 6-Diazo-5-oxo-L-norleucine

    6-Diazo-5-oxo-L-norleucine | 0543-D106-1MG

    €425.00
    6-Diazo-5-oxo-L-norleucine | 0543-D106-1MG| Gentaur Distribution US, UK & Europe This 6-Diazo-5-oxo-L-norleucine | 0543-D106-1MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €425.00
    Quick view
    Qty in Cart: 0
    Price:
    €425.00
    Subtotal:
  • 6-Diazo-5-oxo-L-nor-Leucine

    6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-5

    €305.00
    6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-5| Gentaur Distribution US, UK & Europe This 6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €305.00
    Quick view
    Qty in Cart: 0
    Price:
    €305.00
    Subtotal:
  • 6-Diazo-5-oxo-L-nor-Leucine

    6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-1

    €155.00
    6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-1| Gentaur Distribution US, UK & Europe This 6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €155.00
    Quick view
    Qty in Cart: 0
    Price:
    €155.00
    Subtotal:
  • 6-Benzylaminopurine, CAS# 1214-39-7

    6-Benzylaminopurine, CAS# 1214-39-7 | 0607-C6901-100MG

    €260.00
    6-Benzylaminopurine, CAS# 1214-39-7 | 0607-C6901-100MG| Gentaur Distribution US, UK & Europe This 6-Benzylaminopurine, CAS# 1214-39-7 | 0607-C6901-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
    €260.00
    Quick view
    Qty in Cart: 0
    Price:
    €260.00
    Subtotal:
  • 6-Benzylaminopurine cas:1214-39-7 -100 mg

    6-Benzylaminopurine cas:1214-39-7 -100 mg | 0804-HY-B0941 - 100mg

    €168.00
    6-Benzylaminopurine cas:1214-39-7 -100 mg | 0804-HY-B0941 - 100mg| Gentaur Distribution US, UK & Europe This 6-Benzylaminopurine cas:1214-39-7 -100 mg | 0804-HY-B0941 - 100mg is guaranteed Product with the use of CMV and directly supplied to your...
    €168.00
    Quick view
    Qty in Cart: 0
    Price:
    €168.00
    Subtotal:
  • 6'-Sialyllactose Sodium Salt 157574-76-0 Spec

    6'-Sialyllactose Sodium Salt 157574-76-0 Spec | 0931-T37347-50mg

    €450.00
    6'-Sialyllactose Sodium Salt 157574-76-0 Spec | 0931-T37347-50mg| Gentaur Distribution US, UK & Europe This 6'-Sialyllactose Sodium Salt 157574-76-0 Spec | 0931-T37347-50mg is guaranteed Product with the use of CMV and directly supplied to your...
    €450.00
    Quick view
    Qty in Cart: 0
    Price:
    €450.00
    Subtotal:
  • 5’-Hydroxyphenyl Carvedilol (CAS N°142227-51-8)

    5’-Hydroxyphenyl Carvedilol (CAS N°142227-51-8) | 0572-TRC-H949125-25MG

    €1,716.00
    5’-Hydroxyphenyl Carvedilol (CAS N°142227-51-8) | 0572-TRC-H949125-25MG| Gentaur Distribution US, UK & Europe This 5’-Hydroxyphenyl Carvedilol (CAS N°142227-51-8) | 0572-TRC-H949125-25MG is guaranteed Product with the use of CMV and directly...
    €1,716.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,716.00
    Subtotal:
  • 5-Hydroxymethyl-dC

    5-Hydroxymethyl-dC | 0220-N-1070-100

    €295.00
    5-Hydroxymethyl-dC | 0220-N-1070-100| Gentaur Distribution US, UK & Europe This 5-Hydroxymethyl-dC | 0220-N-1070-100 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €295.00
    Quick view
    Qty in Cart: 0
    Price:
    €295.00
    Subtotal:
  • 5-Formyl-dC

    5-Formyl-dC | 0220-N-1069-5

    €257.00
    5-Formyl-dC | 0220-N-1069-5| Gentaur Distribution US, UK & Europe This 5-Formyl-dC | 0220-N-1069-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €257.00
    Quick view
    Qty in Cart: 0
    Price:
    €257.00
    Subtotal:
  • 5-Ethynyl-uridine (5-EU) (CAS N° 69075-42-9)

    5-Ethynyl-uridine (5-EU) (CAS N° 69075-42-9) | 0220-CLK-N002-10

    €232.00
    5-Ethynyl-uridine (5-EU) (CAS N° 69075-42-9) | 0220-CLK-N002-10| Gentaur Distribution US, UK & Europe This 5-Ethynyl-uridine (5-EU) (CAS N° 69075-42-9) | 0220-CLK-N002-10 is guaranteed Product with the use of CMV and directly supplied to your lab...
    €232.00
    Quick view
    Qty in Cart: 0
    Price:
    €232.00
    Subtotal:
  • 5-Carboxy-dC

    5-Carboxy-dC | 0220-N-1067-5

    €237.00
    5-Carboxy-dC | 0220-N-1067-5| Gentaur Distribution US, UK & Europe This 5-Carboxy-dC | 0220-N-1067-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €237.00
    Quick view
    Qty in Cart: 0
    Price:
    €237.00
    Subtotal:
  • 4a-Hydroxycholesterol – 5mg

    4a-Hydroxycholesterol – 5mg | 0572-H917975

    €1,685.00
    4a-Hydroxycholesterol – 5mg | 0572-H917975| Gentaur Distribution US, UK & Europe This 4a-Hydroxycholesterol – 5mg | 0572-H917975 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
    €1,685.00
    Quick view
    Qty in Cart: 0
    Price:
    €1,685.00
    Subtotal:
  • 4-Hydroperoxycyclophosphamide Biochemical, 1 MG

    4-Hydroperoxycyclophosphamide Biochemical, 1 MG | 0544-MBS6066131-1MG

    €765.00
    4-Hydroperoxycyclophosphamide Biochemical, 1 MG | 0544-MBS6066131-1MG| Gentaur Distribution US, UK & Europe This 4-Hydroperoxycyclophosphamide Biochemical, 1 MG | 0544-MBS6066131-1MG is guaranteed Product with the use of CMV and directly supplied...
    €765.00
    Quick view
    Qty in Cart: 0
    Price:
    €765.00
    Subtotal:
  • Total: items /

Adding your products to cart