Compare Quick view DETERMINE™ HIV EARLY DETECT | 0173-7D2847 MSRP: Now: €660.00 Was: DETERMINE™ HIV EARLY DETECT | 0173-7D2847 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €660.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €660.00 Was: Subtotal:
Compare Quick view DETERMINE™ HBsAg 2, 20 tests | 0173-TD2946 MSRP: Now: €265.00 Was: DETERMINE™ HBsAg 2, 20 tests | 0173-TD2946 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €265.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €265.00 Was: Subtotal:
Compare Quick view DCR Basal Salt Mixture, 50 L | 0468-30630088-4 MSRP: Now: €242.00 Was: DCR Basal Salt Mixture, 50 L | 0468-30630088-4 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €242.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €242.00 Was: Subtotal:
Compare Quick view DBCO-PEG-SC, 2K | 0695-DBCO-PEG-SC, 2K MSRP: Now: €788.00 Was: DBCO-PEG-SC, 2K | 0695-DBCO-PEG-SC, 2K | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €788.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €788.00 Was: Subtotal:
Compare Quick view DBCO-PEG-NHS, 1K | 0695-HE048023-1K MSRP: Now: €788.00 Was: DBCO-PEG-NHS, 1K | 0695-HE048023-1K | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €788.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €788.00 Was: Subtotal:
Compare Quick view DB3.1 Escherichia coli Strains 2ul | 0820-S0043 MSRP: Now: €476.00 Was: DB3.1 Escherichia coli Strains 2ul | 0820-S0043 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €476.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €476.00 Was: Subtotal:
Compare Quick view DAF-2 DA CAS: 205391-02-2| 0271-16294 MSRP: Now: €510.00 Was: DAF-2 DA CAS: 205391-02-2| 0271-16294 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €510.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €510.00 Was: Subtotal:
Compare Quick view DAB Substrate (High Contrast) | 0316-ACU250 MSRP: Now: €260.00 Was: DAB Substrate (High Contrast) | 0316-ACU250 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €260.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €260.00 Was: Subtotal:
Compare Quick view DAB Chromogen Concentrate | 0316-ACB030 MSRP: Now: €317.00 Was: DAB Chromogen Concentrate | 0316-ACB030 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €317.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €317.00 Was: Subtotal:
Compare Quick view D9-THC-COOH-HRP | OORB00103-500UL MSRP: Now: €469.00 Was: D9-THC-COOH-HRP | OORB00103-500UL | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €469.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €469.00 Was: Subtotal:
Compare Quick view D-LYSINE MONOHYDROCHLORIDE, 98%, 5X1G | 0072-L07710.06 MSRP: Now: €280.00 Was: D-LYSINE MONOHYDROCHLORIDE, 98%, 5X1G | 0072-L07710.06 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €280.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €280.00 Was: Subtotal:
Compare Quick view D-8147 Duvelisib, Free Base, >99%, 500ug | 0111-D-8147-500ug MSRP: Now: €8,125.00 Was: D-8147 Duvelisib, Free Base, >99%, 500ug | 0111-D-8147-500ug | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €8,125.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €8,125.00 Was: Subtotal:
Compare Quick view D-5678 Dabrafenib, Free Base, >99%, 2g | 0111-D-5678-2g MSRP: Now: €809.00 Was: D-5678 Dabrafenib, Free Base, >99%, 2g | 0111-D-5678-2g | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €809.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €809.00 Was: Subtotal:
Compare Quick view D-(+)-Trehalose Solution, 1M, 500ml | 0794-AMS.TS1M-500 MSRP: Now: €1,465.00 Was: D-(+)-Trehalose Solution, 1M, 500ml | 0794-AMS.TS1M-500 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,465.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,465.00 Was: Subtotal:
Compare Quick view D-(+)-Trehalose Solution, 1M, 100 ml | 0794-AMS.TS1M-100 MSRP: Now: €399.00 Was: D-(+)-Trehalose Solution, 1M, 100 ml | 0794-AMS.TS1M-100 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €399.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €399.00 Was: Subtotal:
Compare Quick view D-(+)-Saccharose | 0941-S0111-500G MSRP: Now: €118.00 Was: D-(+)-Saccharose | 0941-S0111-500G | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €118.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €118.00 Was: Subtotal:
Compare Quick view Cytophaga Agar Base, 500g | 1124-HDC7731-500g MSRP: Now: €7,598.00 Was: Cytophaga Agar Base, 500g | 1124-HDC7731-500g | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €7,598.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €7,598.00 Was: Subtotal:
Compare Quick view Cytomegalovirus Virclia ® IgM Monotest 24T | 0556-N26-VCM022 MSRP: Now: €1,925.00 Was: Cytomegalovirus Virclia ® IgM Monotest 24T | 0556-N26-VCM022 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,925.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,925.00 Was: Subtotal:
Compare Quick view Cytokeratin Cocktail (CK cocktail), 1.0 ml | 0436-MM-1012-02 MSRP: Now: €727.00 Was: Cytokeratin Cocktail (CK cocktail), 1.0 ml | 0436-MM-1012-02 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €727.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €727.00 Was: Subtotal:
Compare Quick view CytoSelect™ 96-well Phagocytosis Assay (Zymosan) | 0197-CBA-224 MSRP: Now: €950.00 Was: CytoSelect™ 96-well Phagocytosis Assay (Zymosan) | 0197-CBA-224 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €950.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €950.00 Was: Subtotal:
Compare Quick view CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 96Т | 0197-CBA-150 MSRP: Now: €976.00 Was: CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 96Т | 0197-CBA-150 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your... MSRP: Now: €976.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €976.00 Was: Subtotal:
Compare Quick view CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 5X96 tests | 0197-CBA-150-5 MSRP: Now: €3,722.00 Was: CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 5X96 tests | 0197-CBA-150-5 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied... MSRP: Now: €3,722.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €3,722.00 Was: Subtotal:
Compare Quick view CytoSelect™ 96-Well Phagocytosis Assay (E. coli, Colorimetric Format) | 0197-CBA-222 MSRP: Now: €864.00 Was: CytoSelect™ 96-Well Phagocytosis Assay (E. coli, Colorimetric Format) | 0197-CBA-222 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's... MSRP: Now: €864.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €864.00 Was: Subtotal:
Compare Quick view CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120-5 MSRP: Now: €2,600.00 Was: CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120-5 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €2,600.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €2,600.00 Was: Subtotal:
Compare Quick view CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120 MSRP: Now: €980.00 Was: CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €980.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €980.00 Was: Subtotal:
Compare Quick view CytoFix™ Red Lysosomal Stain | 0271-23210 MSRP: Now: €524.00 Was: CytoFix™ Red Lysosomal Stain | 0271-23210 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €524.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €524.00 Was: Subtotal:
Compare Quick view Cyto-Tek Holder Base 1mL 200/Ca | 0094-4336 MSRP: Now: €105,833.00 Was: Cyto-Tek Holder Base 1mL 200/Ca | 0094-4336 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €105,833.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €105,833.00 Was: Subtotal:
Compare Quick view Cyto-Tek 1 ml Fluid Chamber, 200/cs | 0094-4329 MSRP: Now: €1,060.00 Was: Cyto-Tek 1 ml Fluid Chamber, 200/cs | 0094-4329 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,060.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,060.00 Was: Subtotal:
Compare Quick view Cyto-Tek 1 ml Chamber Cap, 200/cs | 0094-4335 MSRP: Now: €195.00 Was: Cyto-Tek 1 ml Chamber Cap, 200/cs | 0094-4335 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €195.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €195.00 Was: Subtotal:
Compare Quick view Cyt c | Cytochrome c | 0451-AS08 343A MSRP: Now: €500.00 Was: Cyt c | Cytochrome c | 0451-AS08 343A | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €500.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €500.00 Was: Subtotal:
Compare Quick view Cynomolgus Monkey PBMCs | 0708-NHP-PC001 MSRP: Now: €4,108.00 Was: Cynomolgus Monkey PBMCs | 0708-NHP-PC001 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €4,108.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €4,108.00 Was: Subtotal:
Compare Quick view Cyclosporine A-HRP conjugate 1mg | 0271-Cyclosporine A-HRP conjugate MSRP: Now: €5,103.00 Was: Cyclosporine A-HRP conjugate 1mg | 0271-Cyclosporine A-HRP conjugate | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €5,103.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €5,103.00 Was: Subtotal:
Compare Quick view Cycloheximide Solution (10% in DMSO Sterile), 10x1 mL | 0543-C084-10x1ML MSRP: Now: €293.00 Was: Cycloheximide Solution (10% in DMSO Sterile), 10x1 mL | 0543-C084-10x1ML | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €293.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €293.00 Was: Subtotal:
Compare Quick view Cyclic citrullinated peptide-BSA(CCP-BSA)size 100 ug | 0426-E64I00802 MSRP: Now: €559.00 Was: Cyclic citrullinated peptide-BSA(CCP-BSA)size 100 ug | 0426-E64I00802 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €559.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €559.00 Was: Subtotal:
Compare Quick view Cyanine5 maleimide, 50 m | 0051-53080-50mg MSRP: Now: €8,366.00 Was: Cyanine5 maleimide, 50 m | 0051-53080-50mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €8,366.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €8,366.00 Was: Subtotal:
Compare Quick view Cyanine 3-dCTP | 0607-B8159-25ul-(10 mM) MSRP: Now: €821.00 Was: Cyanine 3-dCTP | 0607-B8159-25ul-(10 mM) | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €821.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €821.00 Was: Subtotal:
Compare Quick view Cyanine 3-dCTP | 0607-B8159-10ul-(10 mM) MSRP: Now: €630.00 Was: Cyanine 3-dCTP | 0607-B8159-10ul-(10 mM) | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €630.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €630.00 Was: Subtotal:
Compare Quick view Cyanine 3-dCTP | 0607-B8159-100ul-(10 mM) MSRP: Now: €2,397.00 Was: Cyanine 3-dCTP | 0607-B8159-100ul-(10 mM) | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €2,397.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €2,397.00 Was: Subtotal:
Compare Quick view CyTCRB-APC | 0733-CYT-BF1AP MSRP: Now: €905.00 Was: CyTCRB-APC | 0733-CYT-BF1AP | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €905.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €905.00 Was: Subtotal:
Compare Quick view Cy5-PEG-SH, 1K, 50 mg | 0695-FL078003-1K MSRP: Now: €775.00 Was: Cy5-PEG-SH, 1K, 50 mg | 0695-FL078003-1K | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €775.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €775.00 Was: Subtotal:
Compare Quick view Cy3 tetrazine | 0220-910 MSRP: Now: €2,455.00 Was: Cy3 tetrazine | 0220-910 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €2,455.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €2,455.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 5 MG | 0399-CSB-CS(P)-003 MSRP: Now: €700.00 Was: Customer service:Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 5 MG | 0399-CSB-CS(P)-003 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied... MSRP: Now: €700.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €700.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg | 0399-CSB-CS(P)-003-3MG MSRP: Now: €710.00 Was: Customer service:Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg | 0399-CSB-CS(P)-003-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly... MSRP: Now: €710.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €710.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 5 MG | 0399-CSB-CS(P)-005 MSRP: Now: €999.00 Was: Customer service:Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 5 MG | 0399-CSB-CS(P)-005 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €999.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €999.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399-SB-CS(P)-005-3MG MSRP: Now: €949.00 Was: Customer service:Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399-SB-CS(P)-005-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €949.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €949.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399-CSB-CS(P)-005-3MG MSRP: Now: €953.00 Was: Customer service:Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399-CSB-CS(P)-005-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €953.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €953.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 5 MG | 0399-CSB-CS(P)-006 MSRP: Now: €940.00 Was: Customer service:Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 5 MG | 0399-CSB-CS(P)-006 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €940.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €940.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3MG | 0399-SB-CS(P)-006-3MG MSRP: Now: €926.00 Was: Customer service:Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3MG | 0399-SB-CS(P)-006-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €926.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €926.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 3MG | 399-CSB-CS(P)-004-3MG MSRP: Now: €889.00 Was: Customer service:Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 3MG | 399-CSB-CS(P)-004-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly... MSRP: Now: €889.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €889.00 Was: Subtotal:
Compare Quick view Customer service:Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG | 0399-CSB-CS(P)-004 MSRP: Now: €925.00 Was: Customer service:Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG | 0399-CSB-CS(P)-004 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly... MSRP: Now: €925.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €925.00 Was: Subtotal:
Compare Quick view Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 5 MG | 0399-CSB-CS(P)-002 MSRP: Now: €1,099.00 Was: Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 5 MG | 0399-CSB-CS(P)-002 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €1,099.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,099.00 Was: Subtotal:
Compare Quick view Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 3 MG | 0399-CSB-CS(P)-002-3MG MSRP: Now: €965.00 Was: Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 3 MG | 0399-CSB-CS(P)-002-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and... MSRP: Now: €965.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €965.00 Was: Subtotal:
Compare Quick view Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399-CSB-CS(P)-001-3MG MSRP: Now: €953.00 Was: Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399-CSB-CS(P)-001-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly... MSRP: Now: €953.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €953.00 Was: Subtotal:
Compare Quick view Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG | 0399-CSB-CS(P)-001 MSRP: Now: €999.00 Was: Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG | 0399-CSB-CS(P)-001 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied... MSRP: Now: €999.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €999.00 Was: Subtotal:
Compare Quick view Custom Service | 0171-Custom-1 MSRP: Now: €500.00 Was: Custom Service | 0171-Custom-1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €500.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €500.00 Was: Subtotal:
Compare Quick view Custom Oligonucleotide Purification 50-200nmol scale | 0343-26-6400-77 MSRP: Now: €90.00 Was: Custom Oligonucleotide Purification 50-200nmol scale | 0343-26-6400-77 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €90.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €90.00 Was: Subtotal:
Compare Quick view Cultrex™ Reduced Growth Factor Basement Membrane Extract, Type R1, PathClear™ | 0622-3433-001-R1 MSRP: Now: €330.00 Was: Cultrex™ Reduced Growth Factor Basement Membrane Extract, Type R1, PathClear™ | 0622-3433-001-R1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by... MSRP: Now: €330.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €330.00 Was: Subtotal:
Compare Quick view Cultrex RGF Basement Membrane Extract, Type 2, | 0622-3533-010-02 MSRP: Now: €631.00 Was: Cultrex RGF Basement Membrane Extract, Type 2, | 0622-3533-010-02 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €631.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €631.00 Was: Subtotal:
Compare Quick view Cultrex 3-D Culture Matrix Laminin I 30mg | 0622-3446-005-01-30mg MSRP: Now: €1,186.00 Was: Cultrex 3-D Culture Matrix Laminin I 30mg | 0622-3446-005-01-30mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,186.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,186.00 Was: Subtotal:
Compare Quick view Cu/ZnSOD | Cu/Zn superoxide dismutase | 0451-AS18 4243 MSRP: Now: €350.00 Was: Cu/ZnSOD | Cu/Zn superoxide dismutase | 0451-AS18 4243 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €350.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €350.00 Was: Subtotal:
Compare Quick view Crystallography Sample Supports SSX24, 50 units | 0414-ML-SXM-B5-24-50 MSRP: Now: €1,379.00 Was: Crystallography Sample Supports SSX24, 50 units | 0414-ML-SXM-B5-24-50 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,379.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,379.00 Was: Subtotal:
Compare Quick view Crystallography Sample Supports SSX22, 50 units | 0414-ML-SXM-B5-22-50 MSRP: Now: €1,379.00 Was: Crystallography Sample Supports SSX22, 50 units | 0414-ML-SXM-B5-22-50 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,379.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,379.00 Was: Subtotal:
Compare Quick view Crystallography Sample Supports SSX21, 50 units | 0414-ML-SXM-B5-21-50 MSRP: Now: €1,379.00 Was: Crystallography Sample Supports SSX21, 50 units | 0414-ML-SXM-B5-21-50 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,379.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,379.00 Was: Subtotal:
Compare Quick view Crystallography Sample Supports SSX1X50 units | 0414-ML-SXM-B5-13-50 MSRP: Now: €1,379.00 Was: Crystallography Sample Supports SSX1X50 units | 0414-ML-SXM-B5-13-50 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,379.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,379.00 Was: Subtotal:
Compare Quick view Crystallography Sample Seals, 100 units | 0414-ML-SXM-RTS-1-100 MSRP: Now: €225.00 Was: Crystallography Sample Seals, 100 units | 0414-ML-SXM-RTS-1-100 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €225.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €225.00 Was: Subtotal:
Compare Quick view Crystalgen SuperClear™ Plates pregreased | 0220-CPL-132 MSRP: Now: €107,195.00 Was: Crystalgen SuperClear™ Plates pregreased | 0220-CPL-132 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €107,195.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €107,195.00 Was: Subtotal:
Compare Quick view Crystal Clear Sealing Film | 1132-HR3-609 MSRP: Now: €422.00 Was: Crystal Clear Sealing Film | 1132-HR3-609 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €422.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €422.00 Was: Subtotal:
Compare Quick view Cryptosporidium spp., 150 test | 0597-Oneq-HA490-150D MSRP: Now: €1,015.00 Was: Cryptosporidium spp., 150 test | 0597-Oneq-HA490-150D | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,015.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,015.00 Was: Subtotal:
Compare Quick view Cryoscope Heat Transfer Fluid - 250mL | 0461-HTF250 MSRP: Now: €185.00 Was: Cryoscope Heat Transfer Fluid - 250mL | 0461-HTF250 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €185.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €185.00 Was: Subtotal:
Compare Quick view Cryopreserve Beads Red | 0183-6087 MSRP: Now: €256.00 Was: Cryopreserve Beads Red | 0183-6087 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €256.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €256.00 Was: Subtotal:
Compare Quick view CryoVial Tong | 0220-X-CC-105 MSRP: Now: €335.00 Was: CryoVial Tong | 0220-X-CC-105 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €335.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €335.00 Was: Subtotal:
Compare Quick view CryoSure-DMSO 6 x 70 ml vials x 10 opak. | 0323-WAK-DMSO-70x10 MSRP: Now: €6,000.00 Was: CryoSure-DMSO 6 x 70 ml vials x 10 opak. | 0323-WAK-DMSO-70x10 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €6,000.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €6,000.00 Was: Subtotal:
Compare Quick view CryoSure-DMSO 6 x 70 ml vials | 0323-WAK-DMSO-70 MSRP: Now: €680.00 Was: CryoSure-DMSO 6 x 70 ml vials | 0323-WAK-DMSO-70 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €680.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €680.00 Was: Subtotal:
Compare Quick view CryoSure-DMSO 6 x 50 ml vials | 0323-WAK-DMSO-50 MSRP: Now: €550.00 Was: CryoSure-DMSO 6 x 50 ml vials | 0323-WAK-DMSO-50 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €550.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €550.00 Was: Subtotal:
Compare Quick view CryoSure-DMSO 10 x 10 ml vials | 0323-WAK-DMSO-10 MSRP: Now: €355.00 Was: CryoSure-DMSO 10 x 10 ml vials | 0323-WAK-DMSO-10 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €355.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €355.00 Was: Subtotal:
Compare Quick view CryoSure-DEX40 25 x 8ml vials | 0323-WAK-DEX40-25 MSRP: Now: €560.00 Was: CryoSure-DEX40 25 x 8ml vials | 0323-WAK-DEX40-25 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €560.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €560.00 Was: Subtotal:
Compare Quick view Cryo-Sentry Level Alarm (HC20 & HC34) | 0414-TW-R037-8C15 MSRP: Now: €2,010.00 Was: Cryo-Sentry Level Alarm (HC20 & HC34) | 0414-TW-R037-8C15 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €2,010.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €2,010.00 Was: Subtotal:
Compare Quick view Cry1Ac/Cry2A/CP4EPSPS(RR) for Cotton | 0881-AID035 MSRP: Now: €568.00 Was: Cry1Ac/Cry2A/CP4EPSPS(RR) for Cotton | 0881-AID035 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €568.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €568.00 Was: Subtotal:
Compare Quick view Crimean-Congo Haemorrhagic Fever Virus | 0512-Path-CCHFV MSRP: Now: €875.00 Was: Crimean-Congo Haemorrhagic Fever Virus | 0512-Path-CCHFV | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €875.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €875.00 Was: Subtotal:
Compare Quick view Creatinine-HRP 0.5ML | 0926-80-1133-0.5ML MSRP: Now: €406.00 Was: Creatinine-HRP 0.5ML | 0926-80-1133-0.5ML | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €406.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €406.00 Was: Subtotal:
Compare Quick view Creatinine amidohydrolase | 1012-HH0106 MSRP: Now: €321.00 Was: Creatinine amidohydrolase | 1012-HH0106 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €321.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €321.00 Was: Subtotal:
Compare Quick view Creatinine N-HRP 500ul | 0926-80-1132-500ul MSRP: Now: €1,642.00 Was: Creatinine N-HRP 500ul | 0926-80-1132-500ul | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,642.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,642.00 Was: Subtotal:
Compare Quick view Creatine amidinohydrolase | 1012-HH0203-01 MSRP: Now: €302.00 Was: Creatine amidinohydrolase | 1012-HH0203-01 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €302.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €302.00 Was: Subtotal:
Compare Quick view Cre-GFP Adeno-associated virus(AAV Serotype 2) | 0743-AAV00062Z MSRP: Now: €3,657.00 Was: Cre-GFP Adeno-associated virus(AAV Serotype 2) | 0743-AAV00062Z | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €3,657.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €3,657.00 Was: Subtotal:
Compare Quick view Cowpox virus End Point 48 rxs | 0597-PCR-V173-48D MSRP: Now: €75,384.00 Was: Cowpox virus End Point 48 rxs | 0597-PCR-V173-48D | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €75,384.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €75,384.00 Was: Subtotal:
Compare Quick view CoverGrip™ Coverslip Sealant | 0037-23005 MSRP: Now: €94.00 Was: CoverGrip™ Coverslip Sealant | 0037-23005 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €94.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €94.00 Was: Subtotal:
Compare Quick view Cotinine (COT) Rapid Test Dipstick-Urine | 0920-DCT-101-50T MSRP: Now: €130.00 Was: Cotinine (COT) Rapid Test Dipstick-Urine | 0920-DCT-101-50T | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €130.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €130.00 Was: Subtotal:
Compare Quick view Corynebacterium bovis | 0597-Oneq-V219-150D MSRP: Now: €785.00 Was: Corynebacterium bovis | 0597-Oneq-V219-150D | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €785.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €785.00 Was: Subtotal:
Compare Quick view Cortisol HRP Conjugate | 0544-MBS342079-0.5ML MSRP: Now: €585.00 Was: Cortisol HRP Conjugate | 0544-MBS342079-0.5ML | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €585.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €585.00 Was: Subtotal:
Compare Quick view Cortisol 3-CMO-BSA, 25 mg | 0118-80-IC20 MSRP: Now: €725.00 Was: Cortisol 3-CMO-BSA, 25 mg | 0118-80-IC20 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €725.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €725.00 Was: Subtotal:
Compare Quick view Corticosterone rat/mouse, 96T | 0403-DEV9922 MSRP: Now: €469.00 Was: Corticosterone rat/mouse, 96T | 0403-DEV9922 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €469.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €469.00 Was: Subtotal:
Compare Quick view Corning® cover glasses rectangular, W × L 24 mm × 40 mm | 0072-CORN2980-244 MSRP: Now: €442.00 Was: Corning® cover glasses rectangular, W × L 24 mm × 40 mm | 0072-CORN2980-244 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €442.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €442.00 Was: Subtotal:
Compare Quick view Corning® Calcein AM Fluorescent Dye, 1 mg | 0072-354217 MSRP: Now: €509.00 Was: Corning® Calcein AM Fluorescent Dye, 1 mg | 0072-354217 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €509.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €509.00 Was: Subtotal:
Compare Quick view Corning® 1000 g HEPES, Powder | 0312-61-034-RR MSRP: Now: €870.00 Was: Corning® 1000 g HEPES, Powder | 0312-61-034-RR | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €870.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €870.00 Was: Subtotal:
Compare Quick view Corning 384 Well Black with Clear Flat Bottom Not Treated Microplate 25 /bag w/out Lid Nonsterile | 0001-3762 MSRP: Now: €2,000.00 Was: Corning 384 Well Black with Clear Flat Bottom Not Treated Microplate 25 /bag w/out Lid Nonsterile | 0001-3762 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to... MSRP: Now: €2,000.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €2,000.00 Was: Subtotal:
Compare Quick view Core Package Price to Include: (ALFRD) Lat Flow Reagent Dispenser & std accessories SPLab02 Syringe Pump (2 lines, digital screen) | 0497-07.701.01 MSRP: Now: €8,584.00 Was: Core Package Price to Include: (ALFRD) Lat Flow Reagent Dispenser & std accessories SPLab02 Syringe Pump (2 lines, digital screen) | 0497-07.701.01 | Gentaur Distribution US, UK & EuropeThis product... MSRP: Now: €8,584.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €8,584.00 Was: Subtotal:
Compare Quick view Copper Tripeptide-1 (GHK-Cu) | 0501-COS-4978 MSRP: Now: €322.00 Was: Copper Tripeptide-1 (GHK-Cu) | 0501-COS-4978 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €322.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €322.00 Was: Subtotal:
Compare Quick view Control Swab Pack (5 positive/5 negative) | 0173-852010 MSRP: Now: €152.00 Was: Control Swab Pack (5 positive/5 negative) | 0173-852010 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €152.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €152.00 Was: Subtotal:
Compare Quick view Contrad® 70, soak cleaner | 0752-18417-1 MSRP: Now: €1,595.00 Was: Contrad® 70, soak cleaner | 0752-18417-1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,595.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,595.00 Was: Subtotal:
Compare Quick view Contagious ecthyma virus | 0597-Oneq-V309-100D MSRP: Now: €1,173.00 Was: Contagious ecthyma virus | 0597-Oneq-V309-100D | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse. MSRP: Now: €1,173.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: €1,173.00 Was: Subtotal: