Gentaur Recombinants Custom Service
Flotillin1 Recombinant
- SKU:
- GEN000076047
- Availability:
- IN STOCK within a Week & CUSTOM MADE in 4 to 6 Weeks
- Size:
- 1 mg, 2 mg, 3 mg, 5 mg, 10 mg & More
- Purity:
- >80%, >90%, >95%
- Expression System:
- E. coli, Yeast, Mammalian, Insect Cell, Others
- Fusion Expression:
- His Tag, FLAG Tag, MBP, GST, trxA, Nus, Biotin, GFP, Others
- Gene, Vector, Primer:
- Customer's or Gentaur's
- Mammalian vector:
- Reporter gene (GFP, AP, LacZ, Luciferase, without reporter gene). Resistant gene (neo, zeocin, hygromycin, blasticidin, Others)
- Prokaryotic host strain:
- BL21(DE3), JM115, Rosetta-GAMI, Others
- Yeast host strain:
- SMD1168, GS115, X-33, Others
- Insect host cell line:
- Sf 9, Sf 21, Sf High Five, Others
- Mammalian host cell line:
- 293, 293T, NIH/3T3, COS-7, CHO, Others
- Tag position:
- 5’ Terminal, 3’ Terminal
- Protein reprocessing:
- Protein renaturation, Remove endotoxin, Filtration sterilization, lyophilization
- Quote:
- Request a Quote for IN STOCK Recombinant
- Form:
- Fulfill Complete Form to DESIGN Your Recombinant
- Note:
- Price is indicative
Description
Flotillin1 Recombinant | GEN000076047 | Gentaur Genprice Custom Service Provider
Gentaur Group specializes in protein expression service with risk-free guarantee. Our Guaranteed Recombinant Protein Expression Service Package consists of codon optimization service, followed by gene synthesis and subcloning, all the way through protein expression and purification. With the risk-free guarantee, no cost will be charged if the project fails. The overall success rate is over 95% in our expression systems. Place your order today to experience unprecedented, high quality services yet competitive pricing Protein Expression Services.
Download the custom service form
1. GUARANTEED RECOMBINANT PACKAGES
a. Risk-free Guaranteed Packages (Tagged:His/MBP/GST)
b. Risk-free Guaranteed Packages (Tag-free)
‐ Gene Synthesis & cloning
‐ Expression pilot study
‐ Scale-up and purification
‐ Tag removal(optional)
‐ Guaranteed quantity of purified protein
‐ QC: SDS-PAGE and Western Blot (Tagged)
Amount: 1 mg - 2 mg - 3 mg - 5 mg - 10 mg (Guaranteed)
Timeline: 4-6 weeks (From gene synthesis to purified proteins)
Purity: 85% - 90% - 95% - 85%
Pricing: $900 - $12 500
NOTE:
- Risk-free for Guaranteed package: Quantity & Purity guaranteed, or it is FREE.
- Pricing applies only if gene construct is provided. Gene synthesis services are available for an additional cost.
- The size of the target protein: 10Kda < Target protein < 100Kda.
- Pricing does not include endotoxin removal or some specific requirements. Additional charges apply for these services.
- Protein solubility is guaranteed but we DO NOT guarantee the bioactivity or functionality. If the protein expresses as inclusion bodies, refolding will be attempted to make the protein soluble.
- Protein is delivered in lyophilized powder whenever possible. If the solubility of protein changes after lyophilization, it will be shipped in liquid form.
- For tagged packages, we may use affinity tags to purify a protein and the final protein would be tag containing. For tag-free packages, we can provide service start with tag-free protein expression, and purified by SEC and ion exchange to ensure proper native folding, or start with fusion tag expression, and purified by tag removal, HIC, SEC or IEX to ensure proper native folding.
- Protein purity is determined by SDS-PAGE, and quantity is determined by Bradford/BCA/A280 assay. Purity determined by HPLC is also available, please inquire for specific requirements.
2. CUSTOM RECOMBINANT PACKAGE (CHARGED BY STEPS)
Step 1: Gene synthesis or Subcloning, Plasmid Prep
Specification:
A). Gene synthesis & sub cloning into expression vector
B). Or provide your expression constructs, we’ll sub-clone your gene into our expression vector
Step 2: Expression Pilot Study
Specification:
Protein expression evaluation and optimization
Optimize and find the purification conditions of your protein (purity>85%)
Step 3: Protein Purification
Specification:
Optimize and find the purification conditions of your protein (purity>85%)
Step 4: Scale-up and purification
Specification:
Large scale expression & purification at your desired quantity (mg to g).
Step 5: Tag removal and endotoxin removal and other steps (Optional)
Specification:
Perform tag removal, endotoxin removal, higher purity and other steps as needed per your request
Step 6: Quality Control testing
Specification:
SDS-PAGE and Western Blot (tagged protein only)
Timeline:
Varies (Please inquire)
Price:
Quote
Deliverables:
‐Weekly progress reports
‐Desired quantity of purified,soluble protein
‐Plasmid(synthesized by us, 2-5ug)
‐QC data
1 Review
-
Gene sequence?
Sequence MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNV KSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIA LETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYT LKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVS AQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIE EQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQE AAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDI LTRLPESVERLTGVSISQVNHKPLRTA