Synthetic Macrothele gigas Delta-hexatoxin-Mg1b, Biotin-tagged | CSB-EP745067MAM(PS)-4MG
(No reviews yet)
Write a Review
- SKU:
- CSB-EP745067MAM(PS)-4MG
- Availability:
- IN STOCK
- Size:
- 4mg
Frequently bought together:
Description
Synthetic Macrothele gigas Delta-hexatoxin-Mg1b, Biotin-tagged | CSB-EP745067MAM(PS)-4MG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
Recombinant Macrothele gigas Delta-hexatoxin-Mg1b, E. coli expression - 100 ug
Gentaur Recombinants Custom Service
€683.00
Synthetic Agelena orientalis U2-agatoxin-Ao1s, Biotin-tagged | CSB-EP316005AEQ(PS)-4MG
€1,865.00
Synthetic Agelena orientalis U2-agatoxin-Ao1s, Biotin-tagged | CSB-EP316005AEQ(PS)-4MG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
Synthetic Oxyopes takobius M-oxotoxin-Ot2d, Biotin-tagged | 0399-CSB-EP307905OGA(PS)-4MG
€1,920.00
Synthetic Oxyopes takobius M-oxotoxin-Ot2d, Biotin-tagged | 0399-CSB-EP307905OGA(PS)-4MG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
Human C1orf54 Polyclonal Antibody Biotin-conjugated | 0399-CSB-PA840992LD01HU-100UG
€374.00
Human C1orf54 Polyclonal Antibody Biotin-conjugated | 0399-CSB-PA840992LD01HU-100UG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's...
Recombinant Rabies virus Glycoprotein (G), partial, Avi-tag Biotinylated | 0399-CSB-EP325676RAF-B-100UG
€1,413.00
Recombinant Rabies virus Glycoprotein (G), partial, Avi-tag Biotinylated | 0399-CSB-EP325676RAF-B-100UG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to...
Recombinant Rabies virus Glycoprotein (G), partial, Avi-tag Biotinylated | 0399-CSB-EP325676RAF-B-1MG
€2,554.00
Recombinant Rabies virus Glycoprotein (G), partial, Avi-tag Biotinylated | 0399-CSB-EP325676RAF-B-1MG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to...
Recombinant Rabies virus Glycoprotein (G), partial, Avi-tag Biotinylated | 0399-CSB-EP325676RAF-B-20UG
€1,180.00
Recombinant Rabies virus Glycoprotein (G), partial, Avi-tag Biotinylated | 0399-CSB-EP325676RAF-B-20UG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to...
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg
€2,249.00
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
Recombinant Human Interleukin-19 (IL19), Biotinylated | 0399-CSB-EP883391HU-B-20UG
€828.00
Recombinant Human Interleukin-19 (IL19), Biotinylated | 0399-CSB-EP883391HU-B-20UG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's...