Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg
(No reviews yet)
Write a Review
- SKU:
- 0399-CSB-DT1442-10x1mg
- Availability:
- IN STOCK
- Size:
- 10x1mg
Frequently bought together:
Description
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg| Gentaur Distribution US, UK & Europe
This Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
Related Products
Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg
€795.00
Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg| Gentaur Distribution US, UK & Europe
This...
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg
€430.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg| Gentaur Distribution US, UK & Europe
This Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg is guaranteed Product with the use of CMV and...
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg
€1,140.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg| Gentaur Distribution US, UK & Europe
This Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg is guaranteed Product with the use of CMV and...
Bovine Serum amyloid A, SAA ELISA Kit | 0399-CSB-E08592b-96T
€860.00
Bovine Serum amyloid A, SAA ELISA Kit | 0399-CSB-E08592b-96T| Gentaur Distribution US, UK & Europe
This Bovine Serum amyloid A, SAA ELISA Kit | 0399-CSB-E08592b-96T is guaranteed Product with...
