Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg
(No reviews yet)
Write a Review
- SKU:
- 0399-CSB-DT1442-10x1mg
- Availability:
- IN STOCK
- Size:
- 10x1mg
Frequently bought together:
Description
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg | Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg
€795.00
Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg | Gentaur Distribution US, UK & EuropeThis product...
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg
€2,249.00
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
Human amyloid beta peptide 1-42, ABeta1-42 Kit ELISA- NR 1, 96 test | 0772-E1264Hu-96
€550.00
Human amyloid beta peptide 1-42, ABeta1-42 Kit ELISA- NR 1, 96 test | 0772-E1264Hu-96| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg
€1,140.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg
€430.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.