Chemicals

Baicalin | 0628-A10121-100mg| Gentaur Distribution US, UK & Europe This Baicalin | 0628-A10121-100mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Bafilomycin A1 | 0607-A8627-1mg| Gentaur Distribution US, UK & Europe This Bafilomycin A1 | 0607-A8627-1mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Background buster (Ready-To-Use) | 0408-NB306-50| Gentaur Distribution US, UK & Europe This Background buster (Ready-To-Use) | 0408-NB306-50 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Background buster (Ready-To-Use) | 0408-NB306| Gentaur Distribution US, UK & Europe This Background buster (Ready-To-Use) | 0408-NB306 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Background Buster, 7 ml (trial size); Ready-To-Use | 0408-NB306-7| Gentaur Distribution US, UK & Europe This Background Buster, 7 ml (trial size); Ready-To-Use | 0408-NB306-7 is guaranteed Product with the use of CMV and directly supplied to your...

BTC, AM (CAS 176767-94-5) | 0271-21054| Gentaur Distribution US, UK & Europe This BTC, AM (CAS 176767-94-5) | 0271-21054 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BSA conjugated Abscisic acid | 0399-CSB-MC00421B0105-1MG| Gentaur Distribution US, UK & Europe This BSA conjugated Abscisic acid | 0399-CSB-MC00421B0105-1MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

BRM961b : Breast carcinoma with matched regional lymph nodes metastasis carcinoma or breast tissue array, including TNM/Stage (AJCC 8th edition), pathology grade and IHC marker ER/PR/Her-2 results, 48 cases/96 cores (core size 1.5mm), | 0131-BRM961b|...

BR20837a : Breast cancer and matched metastatic carcinoma tissue array, including TNM, clinical stage and pathology grade, 104 cases/ 208 cores, replacing BR20837 | 0131-BR20837a| Gentaur Distribution US, UK & Europe This BR20837a : Breast cancer...

BPE (Bovine Pituitary Extract) | 0016-0414| Gentaur Distribution US, UK & Europe This BPE (Bovine Pituitary Extract) | 0016-0414 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BPC 157 (Cas No. 137525-51-0) | 0931-T20561| Gentaur Distribution US, UK & Europe This BPC 157 (Cas No. 137525-51-0) | 0931-T20561 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BMPS (CAS N°55750-62-4 ) | 0931-T14668-500MG| Gentaur Distribution US, UK & Europe This BMPS (CAS N°55750-62-4 ) | 0931-T14668-500MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BMP-22 (CAS N°1306684-90-1) | 0931-T36138-50MG| Gentaur Distribution US, UK & Europe This BMP-22 (CAS N°1306684-90-1) | 0931-T36138-50MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BMP-22 (CAS N°1306684-90-1) | 0931-T36138-5MG| Gentaur Distribution US, UK & Europe This BMP-22 (CAS N°1306684-90-1) | 0931-T36138-5MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BMP-22 (CAS N°1306684-90-1) | 0931-T36138-100MG| Gentaur Distribution US, UK & Europe This BMP-22 (CAS N°1306684-90-1) | 0931-T36138-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-50MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-50MG is guaranteed Product with the use of CMV and directly supplied to your...

BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-5MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-5MG is guaranteed Product with the use of CMV and directly supplied to your lab...

BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-25MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-25MG is guaranteed Product with the use of CMV and directly supplied to your...

BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-200MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-200MG is guaranteed Product with the use of CMV and directly supplied to your...

BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-100MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-100MG is guaranteed Product with the use of CMV and directly supplied to your...

BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-10MG| Gentaur Distribution US, UK & Europe This BMP signaling agonist sb4 (CAS N° 100874-08-6) | 0931-T7799-10MG is guaranteed Product with the use of CMV and directly supplied to your...

BIOPHEN CS-01(81) | 0735-229005| Gentaur Distribution US, UK & Europe This BIOPHEN CS-01(81) | 0735-229005 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

BIC14011b : Pancreas intraepithelial neoplasia(PanIN), pancreatitis and cancer tissue array, including pathology grade, TNM and clinical stage, 24 cases/48 cores, replacing BIC14011a | 0131-BIC14011b| Gentaur Distribution US, UK & Europe This...

Avibactam | 0628-A11299-25mg| Gentaur Distribution US, UK & Europe This Avibactam | 0628-A11299-25mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Astragaloside IV | 0804-HY-N0431-10mg| Gentaur Distribution US, UK & Europe This Astragaloside IV | 0804-HY-N0431-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Astragaloside III | 0804-HY-N0434-5mg| Gentaur Distribution US, UK & Europe This Astragaloside III | 0804-HY-N0434-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Astragaloside II | 0804-HY-N0433-10mg| Gentaur Distribution US, UK & Europe This Astragaloside II | 0804-HY-N0433-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Astragaloside I | 0804-HY-N0432-10mg| Gentaur Distribution US, UK & Europe This Astragaloside I | 0804-HY-N0432-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Artesunate ( CAS N°88495-63-0) | 0862-GA7503-10MG| Gentaur Distribution US, UK & Europe This Artesunate ( CAS N°88495-63-0) | 0862-GA7503-10MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Arachis hypogaea Lectin (PNA) | 0468-21510927-1| Gentaur Distribution US, UK & Europe This Arachis hypogaea Lectin (PNA) | 0468-21510927-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Arachis hypogaea Lectin (PNA) | 0468-21761089-1| Gentaur Distribution US, UK & Europe This Arachis hypogaea Lectin (PNA) | 0468-21761089-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-1| Gentaur Distribution US, UK & Europe This Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-5| Gentaur Distribution US, UK & Europe This Arachis hypogaea (Peanut) Lectin (PNA) | 0468-21510000-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Arabinoxylan 98%. Food grade. 1kg // MOQ 1kg | 0731-EXTZ-463-1kg| Gentaur Distribution US, UK & Europe This Arabinoxylan 98%. Food grade. 1kg // MOQ 1kg | 0731-EXTZ-463-1kg is guaranteed Product with the use of CMV and directly supplied to your...

Arabinogalactans 99% 1kg // MOQ:1KG | 0731-CEFX-081-1kg| Gentaur Distribution US, UK & Europe This Arabinogalactans 99% 1kg // MOQ:1KG | 0731-CEFX-081-1kg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Apple Pectin Powder. 100kg // MOQ:100kg. | 0731-APPC-100-100kg| Gentaur Distribution US, UK & Europe This Apple Pectin Powder. 100kg // MOQ:100kg. | 0731-APPC-100-100kg is guaranteed Product with the use of CMV and directly supplied to your lab by...

Anthopleurin-A- (Cas No : 60880-63-9)- 0.1 mg | 0121-4030365| Gentaur Distribution US, UK & Europe This Anthopleurin-A- (Cas No : 60880-63-9)- 0.1 mg | 0121-4030365 is guaranteed Product with the use of CMV and directly supplied to your lab by...

Angiotensin 1/2 (1-9) | 0607-A1007-10mg| Gentaur Distribution US, UK & Europe This Angiotensin 1/2 (1-9) | 0607-A1007-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Angiotensin 1/2 (1-9) | 0607-A10007-10mg| Gentaur Distribution US, UK & Europe This Angiotensin 1/2 (1-9) | 0607-A10007-10mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg| Gentaur Distribution US, UK & Europe This Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1...

Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg| Gentaur Distribution US, UK & Europe This Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1...

Ampicillin Trihydrate, EP, 1 kg | 0543-A020-1KG/C| Gentaur Distribution US, UK & Europe This Ampicillin Trihydrate, EP, 1 kg | 0543-A020-1KG/C is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Amphotericin B | 0862-GA8986-100mg| Gentaur Distribution US, UK & Europe This Amphotericin B | 0862-GA8986-100mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Amphetamine-d11 | 0572-A634251| Gentaur Distribution US, UK & Europe This Amphetamine-d11 | 0572-A634251 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Amoxicillin Trihydrate, 1 Kg | 0543-A004-1KG/C| Gentaur Distribution US, UK & Europe This Amoxicillin Trihydrate, 1 Kg | 0543-A004-1KG/C is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Alpha-Tocopherol-d6 Acetate (CAS N°143731-16-2) | 0572-TRC-T526117-10MG| Gentaur Distribution US, UK & Europe This Alpha-Tocopherol-d6 Acetate (CAS N°143731-16-2) | 0572-TRC-T526117-10MG is guaranteed Product with the use of CMV and directly...

Alpha Synuclein Pre-formed Fibrils (Type 1) | 0400-SPR-322XE-500UG| Gentaur Distribution US, UK & Europe This Alpha Synuclein Pre-formed Fibrils (Type 1) | 0400-SPR-322XE-500UG is guaranteed Product with the use of CMV and directly supplied to...

Alpelisib (CAS# 1217486-61-7) | 0804-HY-15244-1G| Gentaur Distribution US, UK & Europe This Alpelisib (CAS# 1217486-61-7) | 0804-HY-15244-1G is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Allium sativum Lectin (ASA) | 0468-21510978-1| Gentaur Distribution US, UK & Europe This Allium sativum Lectin (ASA) | 0468-21510978-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Agarose, Molecular Biology Grade, 1kg | 0304-PC0701-1kg| Gentaur Distribution US, UK & Europe This Agarose, Molecular Biology Grade, 1kg | 0304-PC0701-1kg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Agaricus bisporus Lectin (ABA/ABL) | 0468-21510154-1| Gentaur Distribution US, UK & Europe This Agaricus bisporus Lectin (ABA/ABL) | 0468-21510154-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Adalimumab Biosimilar (Research Grade) | 0879-KBIY400-5MG| Gentaur Distribution US, UK & Europe This Adalimumab Biosimilar (Research Grade) | 0879-KBIY400-5MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Actinomycin D (CAS N°50-76-0)- 10 mg | 0862-GA0481-10MG| Gentaur Distribution US, UK & Europe This Actinomycin D (CAS N°50-76-0)- 10 mg | 0862-GA0481-10MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Acrolein (stabilized with Hydroquinone) 1g [cas:107-02-8] | 0572-TRC-A191200-1G| Gentaur Distribution US, UK & Europe This Acrolein (stabilized with Hydroquinone) 1g [cas:107-02-8] | 0572-TRC-A191200-1G is guaranteed Product with the use of CMV...

Acetyl tetrapeptide-3 Acetate | 0931-TP2364L| Gentaur Distribution US, UK & Europe This Acetyl tetrapeptide-3 Acetate | 0931-TP2364L is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Acetamiprid (Purity: >99.8%) | 0804-HY-B0823-100MG| Gentaur Distribution US, UK & Europe This Acetamiprid (Purity: >99.8%) | 0804-HY-B0823-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Accu-Tell® Typhoid Cassette (Serum/Plasma) | 0826-ABT-IDT-B263| Gentaur Distribution US, UK & Europe This Accu-Tell® Typhoid Cassette (Serum/Plasma) | 0826-ABT-IDT-B263 is guaranteed Product with the use of CMV and directly supplied to your lab by...

Accu-Tell® Troponin I Cassette (Whole Blood/Serum/Plasma) | 0826-ABT-CT-B59| Gentaur Distribution US, UK & Europe This Accu-Tell® Troponin I Cassette (Whole Blood/Serum/Plasma) | 0826-ABT-CT-B59 is guaranteed Product with the use of CMV and...

Accu-Tell® Strep A Cassette (Throat Swab) | 0826-ABT-IDT-B15| Gentaur Distribution US, UK & Europe This Accu-Tell® Strep A Cassette (Throat Swab) | 0826-ABT-IDT-B15 is guaranteed Product with the use of CMV and directly supplied to your lab by...

Accu-Tell® Malaria P.F./P.V./Pan Cassette (Whole Blood) | 0826-ABT-IDT-B236| Gentaur Distribution US, UK & Europe This Accu-Tell® Malaria P.F./P.V./Pan Cassette (Whole Blood) | 0826-ABT-IDT-B236 is guaranteed Product with the use of CMV and...

Accu-Tell® Influenza A+B Cassette (Swab/Nasal aspirate) | 0826-ABT-IDT-B247| Gentaur Distribution US, UK & Europe This Accu-Tell® Influenza A+B Cassette (Swab/Nasal aspirate) | 0826-ABT-IDT-B247 is guaranteed Product with the use of CMV and...

Accu-Tell® HBsAg/HCV/HIV/Syphilis Combo Cassette (Serum/Plasma) | 0826-ABT-IDT-B78| Gentaur Distribution US, UK & Europe This Accu-Tell® HBsAg/HCV/HIV/Syphilis Combo Cassette (Serum/Plasma) | 0826-ABT-IDT-B78 is guaranteed Product with the use of...

AY 9944(Purity 98%) | 0804-HY-107420-5mg| Gentaur Distribution US, UK & Europe This AY 9944(Purity 98%) | 0804-HY-107420-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

AY 9944 dihydrochloride | 0607-A8658-5mg| Gentaur Distribution US, UK & Europe This AY 9944 dihydrochloride | 0607-A8658-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

ATTO 488 NHS ester | 0271-2815| Gentaur Distribution US, UK & Europe This ATTO 488 NHS ester | 0271-2815 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

ASSY, PKGD, SMALL, BALL VALVE LOCKOUT" | 0079-121540| Gentaur Distribution US, UK & Europe This ASSY, PKGD, SMALL, BALL VALVE LOCKOUT" | 0079-121540 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

ARCA Cy5 EGFP mRNA (5-moUTP) | 0607-R1009-100ug-(1mg/mL)| Gentaur Distribution US, UK & Europe This ARCA Cy5 EGFP mRNA (5-moUTP) | 0607-R1009-100ug-(1mg/mL) is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

AICAR phosphate (CAS N°681006-28-0 ) Spec | 0931-T14149-50MG| Gentaur Distribution US, UK & Europe This AICAR phosphate (CAS N°681006-28-0 ) Spec | 0931-T14149-50MG is guaranteed Product with the use of CMV and directly supplied to your lab by...

AICAR | 0607-A8184-200| Gentaur Distribution US, UK & Europe This AICAR | 0607-A8184-200 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

AICAR (CAS No. : 2627-69-2) | 0804-HY-13417| Gentaur Distribution US, UK & Europe This AICAR (CAS No. : 2627-69-2) | 0804-HY-13417 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

AE-6210-2 Slab Gel Cast, 2-mm 12-well | 0245-2392981| Gentaur Distribution US, UK & Europe This AE-6210-2 Slab Gel Cast, 2-mm 12-well | 0245-2392981 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

ACETONE 99.9% GC GRADE (CAS N°67-64-1) | 0951-0013A| Gentaur Distribution US, UK & Europe This ACETONE 99.9% GC GRADE (CAS N°67-64-1) | 0951-0013A is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

ABO and RhD Blood Grouping Rapid Test Cassette | 0920-OABD-402-25T| Gentaur Distribution US, UK & Europe This ABO and RhD Blood Grouping Rapid Test Cassette | 0920-OABD-402-25T is guaranteed Product with the use of CMV and directly supplied to...

AB-FUBINACA 2-Fluorobenzyl Isomer | 0572-TRC-A112630-100MG| Gentaur Distribution US, UK & Europe This AB-FUBINACA 2-Fluorobenzyl Isomer | 0572-TRC-A112630-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by...

AABD-SH (4-Acetamido-7-mercapto-2, 1, 3-benzoxadiazole 10mg CASNo: 254973-02-9 | 0572-TRC-A104510-10MG| Gentaur Distribution US, UK & Europe This AABD-SH (4-Acetamido-7-mercapto-2, 1, 3-benzoxadiazole 10mg CASNo: 254973-02-9 |...

A5124-250 Meropenem (96036-03-2) 99.63% | 0607-A5124-250| Gentaur Distribution US, UK & Europe This A5124-250 Meropenem (96036-03-2) 99.63% | 0607-A5124-250 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

A Dil w Background-Red Comp 125 mL | 0237-S302283-2| Gentaur Distribution US, UK & Europe This A Dil w Background-Red Comp 125 mL | 0237-S302283-2 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

68 kDa Neurofilament Ag (Bovine) | 0544-MBS537339-0.25MG| Gentaur Distribution US, UK & Europe This 68 kDa Neurofilament Ag (Bovine) | 0544-MBS537339-0.25MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

6-FAM Azide | 0271-955| Gentaur Distribution US, UK & Europe This 6-FAM Azide | 0271-955 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

6-FAM Azide | 0271-133| Gentaur Distribution US, UK & Europe This 6-FAM Azide | 0271-133 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

6-Diazo-5-oxo-L-norleucine | 0543-D106-1MG| Gentaur Distribution US, UK & Europe This 6-Diazo-5-oxo-L-norleucine | 0543-D106-1MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-5| Gentaur Distribution US, UK & Europe This 6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-1| Gentaur Distribution US, UK & Europe This 6-Diazo-5-oxo-L-nor-Leucine | 0804-HY-108357-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

6-Benzylaminopurine, CAS# 1214-39-7 | 0607-C6901-100MG| Gentaur Distribution US, UK & Europe This 6-Benzylaminopurine, CAS# 1214-39-7 | 0607-C6901-100MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

6-Benzylaminopurine cas:1214-39-7 -100 mg | 0804-HY-B0941 - 100mg| Gentaur Distribution US, UK & Europe This 6-Benzylaminopurine cas:1214-39-7 -100 mg | 0804-HY-B0941 - 100mg is guaranteed Product with the use of CMV and directly supplied to your...

6'-Sialyllactose Sodium Salt 157574-76-0 Spec | 0931-T37347-50mg| Gentaur Distribution US, UK & Europe This 6'-Sialyllactose Sodium Salt 157574-76-0 Spec | 0931-T37347-50mg is guaranteed Product with the use of CMV and directly supplied to your...

5’-Hydroxyphenyl Carvedilol (CAS N°142227-51-8) | 0572-TRC-H949125-25MG| Gentaur Distribution US, UK & Europe This 5’-Hydroxyphenyl Carvedilol (CAS N°142227-51-8) | 0572-TRC-H949125-25MG is guaranteed Product with the use of CMV and directly...

5-Hydroxymethyl-dC | 0220-N-1070-100| Gentaur Distribution US, UK & Europe This 5-Hydroxymethyl-dC | 0220-N-1070-100 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

5-Formyl-dC | 0220-N-1069-5| Gentaur Distribution US, UK & Europe This 5-Formyl-dC | 0220-N-1069-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

5-Ethynyl-uridine (5-EU) (CAS N° 69075-42-9) | 0220-CLK-N002-10| Gentaur Distribution US, UK & Europe This 5-Ethynyl-uridine (5-EU) (CAS N° 69075-42-9) | 0220-CLK-N002-10 is guaranteed Product with the use of CMV and directly supplied to your lab...

5-Carboxy-dC | 0220-N-1067-5| Gentaur Distribution US, UK & Europe This 5-Carboxy-dC | 0220-N-1067-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

4a-Hydroxycholesterol – 5mg | 0572-H917975| Gentaur Distribution US, UK & Europe This 4a-Hydroxycholesterol – 5mg | 0572-H917975 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

4-Nitrophenyl β-D-glucopyranoside, CAS# 2492-87-7, Purity: >99% | 0804-HY-15927-5G| Gentaur Distribution US, UK & Europe This 4-Nitrophenyl β-D-glucopyranoside, CAS# 2492-87-7, Purity: >99% | 0804-HY-15927-5G is guaranteed Product with the use of...

4-Hydroperoxycyclophosphamide Biochemical, 1 MG | 0544-MBS6066131-1MG| Gentaur Distribution US, UK & Europe This 4-Hydroperoxycyclophosphamide Biochemical, 1 MG | 0544-MBS6066131-1MG is guaranteed Product with the use of CMV and directly supplied...

4-Aminobutyric acid, Inhibitor, 500mg | 0544-MBS3605041-500 mg| Gentaur Distribution US, UK & Europe This 4-Aminobutyric acid, Inhibitor, 500mg | 0544-MBS3605041-500 mg is guaranteed Product with the use of CMV and directly supplied to your lab by...

4 alpha-Hydroxy Cholesterol Biochemical | 0544-MBS6076531-5| Gentaur Distribution US, UK & Europe This 4 alpha-Hydroxy Cholesterol Biochemical | 0544-MBS6076531-5 is guaranteed Product with the use of CMV and directly supplied to your lab by...

3X FLAG peptide TFA | 0931-TP1275-5mg| Gentaur Distribution US, UK & Europe This 3X FLAG peptide TFA | 0931-TP1275-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

3X (DYKDDDDK) Peptide | 0607-A6001-4mg| Gentaur Distribution US, UK & Europe This 3X (DYKDDDDK) Peptide | 0607-A6001-4mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

3X (DYKDDDDK) Peptide | 0607-A6001-25MG| Gentaur Distribution US, UK & Europe This 3X (DYKDDDDK) Peptide | 0607-A6001-25MG is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

3-Indolebutyric acid (IBA), CAS# 133-32-4 | 0607-B5985-25G| Gentaur Distribution US, UK & Europe This 3-Indolebutyric acid (IBA), CAS# 133-32-4 | 0607-B5985-25G is guaranteed Product with the use of CMV and directly supplied to your lab by...