Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg
- SKU:
- 0607-B6057-5mg
- Availability:
- IN STOCK
- Size:
- 5mg
Frequently bought together:
Description
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg | Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg
€430.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Human amyloid beta peptide 1-42, ABeta1-42 Kit ELISA- NR 1, 96 test | 0772-E1264Hu-96
€550.00
Human amyloid beta peptide 1-42, ABeta1-42 Kit ELISA- NR 1, 96 test | 0772-E1264Hu-96| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
Delamanid-5mg | 0607-C6368-5mg
€21,172.00
Delamanid-5mg | 0607-C6368-5mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Swainsonine (5mg) | 0607-B7316-5MG
€849.00
Swainsonine (5mg) | 0607-B7316-5MG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg
€930.00
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg | Gentaur Distribution US, UK & EuropeThis...