Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg
- SKU:
- 0607-B6057-5mg
- Availability:
- IN STOCK
- Size:
- 5mg
Frequently bought together:
Description
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg| Gentaur Distribution US, UK & Europe
This Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
Related Products
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg
€430.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg| Gentaur Distribution US, UK & Europe
This Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg is guaranteed Product with the use of CMV and...
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg
€930.00
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg| Gentaur Distribution US, UK & Europe
This...
Delamanid-5mg | 0607-C6368-5mg
€21,172.00
Delamanid-5mg | 0607-C6368-5mg| Gentaur Distribution US, UK & Europe
This Delamanid-5mg | 0607-C6368-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by...
Bestatin | 0607-A2575-5mg
€390.00
Bestatin | 0607-A2575-5mg| Gentaur Distribution US, UK & Europe
This Bestatin | 0607-A2575-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...
Cytochalasin D | 0607-B6645-5mg
€751.00
Cytochalasin D | 0607-B6645-5mg| Gentaur Distribution US, UK & Europe
This Cytochalasin D | 0607-B6645-5mg is guaranteed Product with the use of CMV and directly supplied to your lab by...