Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg
- SKU:
- 0607-B6057-1mg
- Availability:
- IN STOCK
- Size:
- 1mg
Frequently bought together:
Description
Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg| Gentaur Distribution US, UK & Europe
This Amyloid β-Peptide (1-42) (human) | 0607-B6057-1mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
Related Products
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg
€1,140.00
Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg| Gentaur Distribution US, UK & Europe
This Amyloid β-Peptide (1-42) (human) | 0607-B6057-5mg is guaranteed Product with the use of CMV and...
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg
€930.00
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg| Gentaur Distribution US, UK & Europe
This...
DYKDDDDK tag Peptide | 0607-A6002-4
€250.00
DYKDDDDK tag Peptide | 0607-A6002-4| Gentaur Distribution US, UK & Europe
This DYKDDDDK tag Peptide | 0607-A6002-4 is guaranteed Product with the use of CMV and directly supplied to your lab...
Cytochalasin D | 0607-B6645-1mg
€442.00
Cytochalasin D | 0607-B6645-1mg| Gentaur Distribution US, UK & Europe
This Cytochalasin D | 0607-B6645-1mg is guaranteed Product with the use of CMV and directly supplied to your lab by...