Dimethylmercury (98% purity) | 0978-593-74-8
- SKU:
- 0978-593-74-8
- Availability:
- IN STOCK
- Size:
- 10 g
Frequently bought together:
Description
Dimethylmercury (98% purity) | 0978-593-74-8 | Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
U69593(Purity 98%), 5 mg | 0804-HY-101762
€450.00
U69593(Purity 98%), 5 mg | 0804-HY-101762| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
AY 9944(Purity 98%) | 0804-HY-107420-5mg
€276.00
AY 9944(Purity 98%) | 0804-HY-107420-5mg | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
RO 116 1148 (CAS N°748763-84-0, Purity : 98% ) | 0931-T34343-5MG
€973.00
RO 116 1148 (CAS N°748763-84-0, Purity : 98% ) | 0931-T34343-5MG| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg
€2,249.00
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% | 0399-CSB-DT0293-500mg| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by...
DAMGO(Purity 98%), 5 mg | 0804-HY-P0210
€297.00
DAMGO(Purity 98%), 5 mg | 0804-HY-P0210 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.