Angiopep-2-Cys- custom peptide sequence TFFYGGSRGKRNNFKTEEYC La purezza:95% purity, 100 mg | 0804-HY-P1351
(No reviews yet)
Write a Review
- SKU:
- 0804-HY-P1351
- Availability:
- IN STOCK
- Size:
- 1 Unit
Frequently bought together:
Description
Angiopep-2-Cys- custom peptide sequence TFFYGGSRGKRNNFKTEEYC La purezza:95% purity, 100 mg | 0804-HY-P1351 | Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
U69593(Purity 98%), 5 mg | 0804-HY-101762
€450.00
U69593(Purity 98%), 5 mg | 0804-HY-101762| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
DAMGO(Purity 98%), 5 mg | 0804-HY-P0210
€297.00
DAMGO(Purity 98%), 5 mg | 0804-HY-P0210 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Customer service:Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg | 0399-CSB-CS(P)-003-3MG
€710.00
Customer service:Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg | 0399-CSB-CS(P)-003-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly...
Dexmedetomidine(Purity 98%), 50 mg | 0804-HY-12719
€279.00
Dexmedetomidine(Purity 98%), 50 mg | 0804-HY-12719 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
ICI 199441(Purity 98%), 5 mg | 0804-HY-101205
€293.00
ICI 199441(Purity 98%), 5 mg | 0804-HY-101205| Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.