AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%), 10 mg | 0015-AH11-P-10
(No reviews yet)
Write a Review
- SKU:
- 0015-AH11-P-10
- Availability:
- IN STOCK
- Size:
- 1 Unit
Frequently bought together:
Description
AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%), 10 mg | 0015-AH11-P-10| Gentaur Distribution US, UK & Europe
This AH1 peptide (gp70 H2-Ld-restricted epitope) (SPSYVYHQF, >95%), 10 mg | 0015-AH11-P-10 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.
Related Products
Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg
€795.00
Amyloid Beta-Peptide (1-40) (human) --> C194H295N53O58S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-COOH Purity: 95% | 0399-CSB-DT1441-10mg| Gentaur Distribution US, UK & Europe
This...
Angiopep-2-Cys- custom peptide sequence TFFYGGSRGKRNNFKTEEYC La purezza:95% purity, 100 mg | 0804-HY-P1351
€1,560.00
Angiopep-2-Cys- custom peptide sequence TFFYGGSRGKRNNFKTEEYC La purezza:95% purity, 100 mg | 0804-HY-P1351| Gentaur Distribution US, UK & Europe
This Angiopep-2-Cys- custom peptide sequence...
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg
€930.00
Amyloid Beta-Peptide (1-42) (human) --> C203H311N55O60S1 NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-COOH Purity: 95% | 0399-CSB-DT1442-10x1mg| Gentaur Distribution US, UK & Europe
This...
AREG blocking peptide, 5x0.1 mg | 0544- MBS3224924-5x0.1 mg
€1,030.00
AREG blocking peptide, 5x0.1 mg | 0544- MBS3224924-5x0.1 mg| Gentaur Distribution US, UK & Europe
This AREG blocking peptide, 5x0.1 mg | 0544- MBS3224924-5x0.1 mg is guaranteed Product with...
CHRNA7 blocking peptide : Nicotinic Acetylcholine Receptor alpha 7 Blocking Peptide, 1 mg | 0544-MBS9621950
€535.00
CHRNA7 blocking peptide :: Nicotinic Acetylcholine Receptor alpha 7 Blocking Peptide, 1 mg | 0544-MBS9621950| Gentaur Distribution US, UK & Europe
This CHRNA7 blocking peptide :: Nicotinic...