Biological Product & Supplies

D-8147 Duvelisib, Free Base, >99%, 500ug | 0111-D-8147-500ug| Gentaur Distribution US, UK & Europe This D-8147 Duvelisib, Free Base, >99%, 500ug | 0111-D-8147-500ug is guaranteed Product with the use of CMV and directly supplied to your lab by...

D-5678 Dabrafenib, Free Base, >99%, 2g | 0111-D-5678-2g| Gentaur Distribution US, UK & Europe This D-5678 Dabrafenib, Free Base, >99%, 2g | 0111-D-5678-2g is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

D-(+)-Trehalose Solution, 1M, 500ml | 0794-AMS.TS1M-500| Gentaur Distribution US, UK & Europe This D-(+)-Trehalose Solution, 1M, 500ml | 0794-AMS.TS1M-500 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

D-(+)-Trehalose Solution, 1M, 100 ml | 0794-AMS.TS1M-100| Gentaur Distribution US, UK & Europe This D-(+)-Trehalose Solution, 1M, 100 ml | 0794-AMS.TS1M-100 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

D-(+)-Saccharose | 0941-S0111-500G| Gentaur Distribution US, UK & Europe This D-(+)-Saccharose | 0941-S0111-500G is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cytophaga Agar Base, 500g | 1124-HDC7731-500g| Gentaur Distribution US, UK & Europe This Cytophaga Agar Base, 500g | 1124-HDC7731-500g is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cytomegalovirus Virclia ® IgM Monotest 24T | 0556-N26-VCM022| Gentaur Distribution US, UK & Europe This Cytomegalovirus Virclia ® IgM Monotest 24T | 0556-N26-VCM022 is guaranteed Product with the use of CMV and directly supplied to your lab by...

Cytokeratin Cocktail (CK cocktail), 1.0 ml | 0436-MM-1012-02| Gentaur Distribution US, UK & Europe This Cytokeratin Cocktail (CK cocktail), 1.0 ml | 0436-MM-1012-02 is guaranteed Product with the use of CMV and directly supplied to your lab by...

CytoSelect™ 96-well Phagocytosis Assay (Zymosan) | 0197-CBA-224| Gentaur Distribution US, UK & Europe This CytoSelect™ 96-well Phagocytosis Assay (Zymosan) | 0197-CBA-224 is guaranteed Product with the use of CMV and directly supplied to your lab...

CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 96Т | 0197-CBA-150| Gentaur Distribution US, UK & Europe This CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 96Т | 0197-CBA-150...

CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 5X96 tests | 0197-CBA-150-5| Gentaur Distribution US, UK & Europe This CytoSelect™ 96-well In Vitro Tumor Sensitivity Assay (Soft Agar Colony Formation), 5X96 tests...

CytoSelect™ 96-Well Phagocytosis Assay (E. coli, Colorimetric Format) | 0197-CBA-222| Gentaur Distribution US, UK & Europe This CytoSelect™ 96-Well Phagocytosis Assay (E. coli, Colorimetric Format) | 0197-CBA-222 is guaranteed Product with the use...

CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120-5| Gentaur Distribution US, UK & Europe This CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120-5 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120| Gentaur Distribution US, UK & Europe This CytoSelect™ 24-well Wound Healing Assay | 0197-CBA-120 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

CytoFix™ Red Lysosomal Stain | 0271-23210| Gentaur Distribution US, UK & Europe This CytoFix™ Red Lysosomal Stain | 0271-23210 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyto-Tek Holder Base 1mL 200/Ca | 0094-4336| Gentaur Distribution US, UK & Europe This Cyto-Tek Holder Base 1mL 200/Ca | 0094-4336 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyto-Tek 1 ml Fluid Chamber, 200/cs | 0094-4329| Gentaur Distribution US, UK & Europe This Cyto-Tek 1 ml Fluid Chamber, 200/cs | 0094-4329 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyto-Tek 1 ml Chamber Cap, 200/cs | 0094-4335| Gentaur Distribution US, UK & Europe This Cyto-Tek 1 ml Chamber Cap, 200/cs | 0094-4335 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyt c | Cytochrome c | 0451-AS08 343A| Gentaur Distribution US, UK & Europe This Cyt c | Cytochrome c | 0451-AS08 343A is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cynomolgus Monkey PBMCs | 0708-NHP-PC001| Gentaur Distribution US, UK & Europe This Cynomolgus Monkey PBMCs | 0708-NHP-PC001 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyclosporine A-HRP conjugate 1mg | 0271-Cyclosporine A-HRP conjugate| Gentaur Distribution US, UK & Europe This Cyclosporine A-HRP conjugate 1mg | 0271-Cyclosporine A-HRP conjugate is guaranteed Product with the use of CMV and directly supplied to...

Cycloheximide Solution (10% in DMSO Sterile), 10x1 mL | 0543-C084-10x1ML| Gentaur Distribution US, UK & Europe This Cycloheximide Solution (10% in DMSO Sterile), 10x1 mL | 0543-C084-10x1ML is guaranteed Product with the use of CMV and directly...

Cyclic citrullinated peptide-BSA（CCP-BSA）size 100 ug | 0426-E64I00802| Gentaur Distribution US, UK & Europe This Cyclic citrullinated peptide-BSA（CCP-BSA）size 100 ug | 0426-E64I00802 is guaranteed Product with the use of CMV and directly supplied...

Cyanine5 maleimide, 50 m | 0051-53080-50mg| Gentaur Distribution US, UK & Europe This Cyanine5 maleimide, 50 m | 0051-53080-50mg is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyanine 3-dCTP | 0607-B8159-25ul-(10 mM)| Gentaur Distribution US, UK & Europe This Cyanine 3-dCTP | 0607-B8159-25ul-(10 mM) is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyanine 3-dCTP | 0607-B8159-10ul-(10 mM)| Gentaur Distribution US, UK & Europe This Cyanine 3-dCTP | 0607-B8159-10ul-(10 mM) is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cyanine 3-dCTP | 0607-B8159-100ul-(10 mM)| Gentaur Distribution US, UK & Europe This Cyanine 3-dCTP | 0607-B8159-100ul-(10 mM) is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CyTCRB-APC | 0733-CYT-BF1AP| Gentaur Distribution US, UK & Europe This CyTCRB-APC | 0733-CYT-BF1AP is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cy5-PEG-SH, 1K, 50 mg | 0695-FL078003-1K| Gentaur Distribution US, UK & Europe This Cy5-PEG-SH, 1K, 50 mg | 0695-FL078003-1K is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cy3 tetrazine | 0220-910| Gentaur Distribution US, UK & Europe This Cy3 tetrazine | 0220-910 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Customer service:Sequence , MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 5 MG | 0399-CSB-CS(P)-003| Gentaur Distribution US, UK & Europe This Customer service:Sequence , MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 5 MG |...

Customer service:Sequence , MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg | 0399-CSB-CS(P)-003-3MG| Gentaur Distribution US, UK & Europe This Customer service:Sequence , MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3...

Customer service:Sequence , MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 5 MG | 0399-CSB-CS(P)-005| Gentaur Distribution US, UK & Europe This Customer service:Sequence ,...

Customer service:Sequence , MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399-SB-CS(P)-005-3MG| Gentaur Distribution US, UK & Europe This Customer service:Sequence ,...

Customer service:Sequence , MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399-CSB-CS(P)-005-3MG| Gentaur Distribution US, UK & Europe This Customer service:Sequence ,...

Customer service:Sequence , MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 5 MG | 0399-CSB-CS(P)-006| Gentaur Distribution US, UK & Europe This Customer service:Sequence ,...

Customer service:Sequence , MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3MG | 0399-SB-CS(P)-006-3MG| Gentaur Distribution US, UK & Europe This Customer service:Sequence ,...

Customer service:Sequence , MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 3MG | 399-CSB-CS(P)-004-3MG| Gentaur Distribution US, UK & Europe This Customer service:Sequence ,...

Customer service:Sequence , MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG | 0399-CSB-CS(P)-004| Gentaur Distribution US, UK & Europe This Customer service:Sequence , MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR,...

Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 5 MG | 0399-CSB-CS(P)-002| Gentaur Distribution US, UK & Europe This Customer service: Sequence...

Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 3 MG | 0399-CSB-CS(P)-002-3MG| Gentaur Distribution US, UK & Europe This Customer service: Sequence...

Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399-CSB-CS(P)-001-3MG| Gentaur Distribution US, UK & Europe This Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG,...

Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG | 0399-CSB-CS(P)-001| Gentaur Distribution US, UK & Europe This Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG |...

Custom Service | 0171-Custom-1| Gentaur Distribution US, UK & Europe This Custom Service | 0171-Custom-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Custom Oligonucleotide Purification 50-200nmol scale | 0343-26-6400-77| Gentaur Distribution US, UK & Europe This Custom Oligonucleotide Purification 50-200nmol scale | 0343-26-6400-77 is guaranteed Product with the use of CMV and directly...

Cultrex™ Reduced Growth Factor Basement Membrane Extract, Type R1, PathClear™ | 0622-3433-001-R1| Gentaur Distribution US, UK & Europe This Cultrex™ Reduced Growth Factor Basement Membrane Extract, Type R1, PathClear™ | 0622-3433-001-R1 is...

Cultrex RGF Basement Membrane Extract, Type 2, | 0622-3533-010-02| Gentaur Distribution US, UK & Europe This Cultrex RGF Basement Membrane Extract, Type 2, | 0622-3533-010-02 is guaranteed Product with the use of CMV and directly supplied to your...

Cultrex 3-D Culture Matrix Laminin I 30mg | 0622-3446-005-01-30mg| Gentaur Distribution US, UK & Europe This Cultrex 3-D Culture Matrix Laminin I 30mg | 0622-3446-005-01-30mg is guaranteed Product with the use of CMV and directly supplied to your...

Cu/ZnSOD | Cu/Zn superoxide dismutase | 0451-AS18 4243| Gentaur Distribution US, UK & Europe This Cu/ZnSOD | Cu/Zn superoxide dismutase | 0451-AS18 4243 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Crystallography Sample Supports SSX24, 50 units | 0414-ML-SXM-B5-24-50| Gentaur Distribution US, UK & Europe This Crystallography Sample Supports SSX24, 50 units | 0414-ML-SXM-B5-24-50 is guaranteed Product with the use of CMV and directly...

Crystallography Sample Supports SSX22, 50 units | 0414-ML-SXM-B5-22-50| Gentaur Distribution US, UK & Europe This Crystallography Sample Supports SSX22, 50 units | 0414-ML-SXM-B5-22-50 is guaranteed Product with the use of CMV and directly...

Crystallography Sample Supports SSX21, 50 units | 0414-ML-SXM-B5-21-50| Gentaur Distribution US, UK & Europe This Crystallography Sample Supports SSX21, 50 units | 0414-ML-SXM-B5-21-50 is guaranteed Product with the use of CMV and directly...

Crystallography Sample Supports SSX1X50 units | 0414-ML-SXM-B5-13-50| Gentaur Distribution US, UK & Europe This Crystallography Sample Supports SSX1X50 units | 0414-ML-SXM-B5-13-50 is guaranteed Product with the use of CMV and directly supplied to...

Crystallography Sample Seals, 100 units | 0414-ML-SXM-RTS-1-100| Gentaur Distribution US, UK & Europe This Crystallography Sample Seals, 100 units | 0414-ML-SXM-RTS-1-100 is guaranteed Product with the use of CMV and directly supplied to your lab...

Crystalgen SuperClear™ Plates pregreased | 0220-CPL-132| Gentaur Distribution US, UK & Europe This Crystalgen SuperClear™ Plates pregreased | 0220-CPL-132 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Crystal Clear Sealing Film | 1132-HR3-609| Gentaur Distribution US, UK & Europe This Crystal Clear Sealing Film | 1132-HR3-609 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cryptosporidium spp., 150 test | 0597-Oneq-HA490-150D| Gentaur Distribution US, UK & Europe This Cryptosporidium spp., 150 test | 0597-Oneq-HA490-150D is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Cryoscope Heat Transfer Fluid - 250mL | 0461-HTF250| Gentaur Distribution US, UK & Europe This Cryoscope Heat Transfer Fluid - 250mL | 0461-HTF250 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cryopreserve Beads Red | 0183-6087| Gentaur Distribution US, UK & Europe This Cryopreserve Beads Red | 0183-6087 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CryoVial Tong | 0220-X-CC-105| Gentaur Distribution US, UK & Europe This CryoVial Tong | 0220-X-CC-105 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CryoSure-DMSO 6 x 70 ml vials x 10 opak. | 0323-WAK-DMSO-70x10| Gentaur Distribution US, UK & Europe This CryoSure-DMSO 6 x 70 ml vials x 10 opak. | 0323-WAK-DMSO-70x10 is guaranteed Product with the use of CMV and directly supplied to your lab by...

CryoSure-DMSO 6 x 70 ml vials | 0323-WAK-DMSO-70| Gentaur Distribution US, UK & Europe This CryoSure-DMSO 6 x 70 ml vials | 0323-WAK-DMSO-70 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CryoSure-DMSO 6 x 50 ml vials | 0323-WAK-DMSO-50| Gentaur Distribution US, UK & Europe This CryoSure-DMSO 6 x 50 ml vials | 0323-WAK-DMSO-50 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CryoSure-DMSO 10 x 10 ml vials | 0323-WAK-DMSO-10| Gentaur Distribution US, UK & Europe This CryoSure-DMSO 10 x 10 ml vials | 0323-WAK-DMSO-10 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CryoSure-DEX40 25 x 8ml vials | 0323-WAK-DEX40-25| Gentaur Distribution US, UK & Europe This CryoSure-DEX40 25 x 8ml vials | 0323-WAK-DEX40-25 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cryo-Sentry Level Alarm (HC20 & HC34) | 0414-TW-R037-8C15| Gentaur Distribution US, UK & Europe This Cryo-Sentry Level Alarm (HC20 & HC34) | 0414-TW-R037-8C15 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Cry1Ac/Cry2A/CP4EPSPS(RR) for Cotton | 0881-AID035| Gentaur Distribution US, UK & Europe This Cry1Ac/Cry2A/CP4EPSPS(RR) for Cotton | 0881-AID035 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Crimean-Congo Haemorrhagic Fever Virus | 0512-Path-CCHFV| Gentaur Distribution US, UK & Europe This Crimean-Congo Haemorrhagic Fever Virus | 0512-Path-CCHFV is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Creatinine-HRP 0.5ML | 0926-80-1133-0.5ML| Gentaur Distribution US, UK & Europe This Creatinine-HRP 0.5ML | 0926-80-1133-0.5ML is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Creatinine amidohydrolase | 1012-HH0106| Gentaur Distribution US, UK & Europe This Creatinine amidohydrolase | 1012-HH0106 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Creatinine N-HRP 500ul | 0926-80-1132-500ul| Gentaur Distribution US, UK & Europe This Creatinine N-HRP 500ul | 0926-80-1132-500ul is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Creatine amidinohydrolase | 1012-HH0203-01| Gentaur Distribution US, UK & Europe This Creatine amidinohydrolase | 1012-HH0203-01 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cre-GFP Adeno-associated virus(AAV Serotype 2) | 0743-AAV00062Z| Gentaur Distribution US, UK & Europe This Cre-GFP Adeno-associated virus(AAV Serotype 2) | 0743-AAV00062Z is guaranteed Product with the use of CMV and directly supplied to your lab...

Cowpox virus End Point 48 rxs | 0597-PCR-V173-48D| Gentaur Distribution US, UK & Europe This Cowpox virus End Point 48 rxs | 0597-PCR-V173-48D is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

CoverGrip™ Coverslip Sealant | 0037-23005| Gentaur Distribution US, UK & Europe This CoverGrip™ Coverslip Sealant | 0037-23005 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cotinine (COT) Rapid Test Dipstick-Urine | 0920-DCT-101-50T| Gentaur Distribution US, UK & Europe This Cotinine (COT) Rapid Test Dipstick-Urine | 0920-DCT-101-50T is guaranteed Product with the use of CMV and directly supplied to your lab by...

Corynebacterium bovis | 0597-Oneq-V219-150D| Gentaur Distribution US, UK & Europe This Corynebacterium bovis | 0597-Oneq-V219-150D is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cortisol HRP Conjugate | 0544-MBS342079-0.5ML| Gentaur Distribution US, UK & Europe This Cortisol HRP Conjugate | 0544-MBS342079-0.5ML is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Cortisol 3-CMO-BSA, 25 mg | 0118-80-IC20| Gentaur Distribution US, UK & Europe This Cortisol 3-CMO-BSA, 25 mg | 0118-80-IC20 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Corticosterone rat/mouse, 96T | 0403-DEV9922| Gentaur Distribution US, UK & Europe This Corticosterone rat/mouse, 96T | 0403-DEV9922 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Corning® cover glasses rectangular, W × L 24 mm × 40 mm | 0072-CORN2980-244| Gentaur Distribution US, UK & Europe This Corning® cover glasses rectangular, W × L 24 mm × 40 mm | 0072-CORN2980-244 is guaranteed Product with the use of CMV and...

Corning® Calcein AM Fluorescent Dye, 1 mg | 0072-354217| Gentaur Distribution US, UK & Europe This Corning® Calcein AM Fluorescent Dye, 1 mg | 0072-354217 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Corning® 1000 g HEPES, Powder | 0312-61-034-RR| Gentaur Distribution US, UK & Europe This Corning® 1000 g HEPES, Powder | 0312-61-034-RR is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Corning 384 Well Black with Clear Flat Bottom Not Treated Microplate 25 /bag w/out Lid Nonsterile | 0001-3762| Gentaur Distribution US, UK & Europe This Corning 384 Well Black with Clear Flat Bottom Not Treated Microplate 25 /bag w/out Lid...

Core Package Price to Include: (ALFRD) Lat Flow Reagent Dispenser & std accessories SPLab02 Syringe Pump (2 lines, digital screen) | 0497-07.701.01| Gentaur Distribution US, UK & Europe This Core Package Price to Include: (ALFRD) Lat Flow Reagent...

Copper Tripeptide-1 (GHK-Cu) | 0501-COS-4978| Gentaur Distribution US, UK & Europe This Copper Tripeptide-1 (GHK-Cu) | 0501-COS-4978 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Control Swab Pack (5 positive/5 negative) | 0173-852010| Gentaur Distribution US, UK & Europe This Control Swab Pack (5 positive/5 negative) | 0173-852010 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Contrad® 70, soak cleaner | 0752-18417-1| Gentaur Distribution US, UK & Europe This Contrad® 70, soak cleaner | 0752-18417-1 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Contagious ecthyma virus | 0597-Oneq-V309-100D| Gentaur Distribution US, UK & Europe This Contagious ecthyma virus | 0597-Oneq-V309-100D is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Constant Temperature Drying Oven, 138L , RT+10℃-250℃ | 0486-BJPX-HDO138| Gentaur Distribution US, UK & Europe This Constant Temperature Drying Oven, 138L , RT+10℃-250℃ | 0486-BJPX-HDO138 is guaranteed Product with the use of CMV and directly...

Conjugated THC-BSA hapten, 1 mg | 0091-80-1051| Gentaur Distribution US, UK & Europe This Conjugated THC-BSA hapten, 1 mg | 0091-80-1051 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Concentrating Solution, 50ml | 0445-90626| Gentaur Distribution US, UK & Europe This Concentrating Solution, 50ml | 0445-90626 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Concanavalin A Magnetic Beads | 0607-K1308-5x1ml| Gentaur Distribution US, UK & Europe This Concanavalin A Magnetic Beads | 0607-K1308-5x1ml is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Concanamycin A [Folimycin] (V-ATPase inhibitor) | 0804-HY-N1724-50UG| Gentaur Distribution US, UK & Europe This Concanamycin A [Folimycin] (V-ATPase inhibitor) | 0804-HY-N1724-50UG is guaranteed Product with the use of CMV and directly supplied to...

Con A Sepharose 4B 100mL | 0001-17044001| Gentaur Distribution US, UK & Europe This Con A Sepharose 4B 100mL | 0001-17044001 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Complete Supplement MIXURE CSM 10g | 0765-G100-10G| Gentaur Distribution US, UK & Europe This Complete Supplement MIXURE CSM 10g | 0765-G100-10G is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Complete Supplement MIXURE CSM 100g | 0765-G100-100G| Gentaur Distribution US, UK & Europe This Complete Supplement MIXURE CSM 100g | 0765-G100-100G is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Complete Freund's Adjuvant, 5 mg/ml, 5 ml | 0445-7023| Gentaur Distribution US, UK & Europe This Complete Freund's Adjuvant, 5 mg/ml, 5 ml | 0445-7023 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's...

Complete Freund's Adjuvant, 4 mg/ml | 0445-7001| Gentaur Distribution US, UK & Europe This Complete Freund's Adjuvant, 4 mg/ml | 0445-7001 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.

Complete Freund's Adjuvant, 3 mg/ml | 0445-7015| Gentaur Distribution US, UK & Europe This Complete Freund's Adjuvant, 3 mg/ml | 0445-7015 is guaranteed Product with the use of CMV and directly supplied to your lab by Gentaur's warehouse.