3-D Life RGD Peptide (1 µmol) | 0601-09-P-001
- SKU:
- 0601-09-P-001
- Availability:
- IN STOCK
- Size:
- 1 µmol
Frequently bought together:
Description
3-D Life RGD Peptide (1 µmol) | 0601-09-P-001 | Gentaur Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
3-D Life RGD Peptide, 3 x 1 µmol | 0601-P10-3
€354.00
3-D Life RGD Peptide, 3 x 1 µmol | 0601-P10-3 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3-D Life Dextranase (500 µl) | 0601-D10-1
€762.00
3-D Life Dextranase (500 µl) | 0601-D10-1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3-D Life SG-Dextran | 0601-M91-3
€198.00
3-D Life SG-Dextran | 0601-M91-3 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3-D Life Dextran-CD Hydrogel SG | 0601-G93-1
€260.00
3-D Life Dextran-CD Hydrogel SG | 0601-G93-1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3-D Life Dextran-PEG Hydrogel SG, 1 kit | 0601-G92-1
€240.00
3-D Life Dextran-PEG Hydrogel SG, 1 kit | 0601-G92-1 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3-D Life FG-Dextran Set | 0601-M92-3
€200.00
3-D Life FG-Dextran Set | 0601-M92-3 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3-D Life PEG-Link (3x 200 µl) | 0601-L50-3
€150.00
3-D Life PEG-Link (3x 200 µl) | 0601-L50-3 | Gentaur Distribution US, UK & EuropeThis product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399-CSB-CS(P)-001-3MG
€953.00
Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399-CSB-CS(P)-001-3MG | Gentaur Distribution US, UK & EuropeThis product is guaranteed and...
hOGG1 Control peptide #1 | 0015-HOGG11-P
€350.00
hOGG1 Control peptide #1 | 0015-HOGG11-P| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.